PDB entry 5h9n

View 5h9n on RCSB PDB site
Description: crystal structure of ltbp1 y114a mutant in complex with leukotriene c4
Deposited on 2015-12-28, released 2016-05-11
The last revision was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipocalin AI-4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7YT09 (Start-155)
      • engineered mutation (113)
  • Heterogens: LTX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h9nA (A:)
    aevtsiptgcnalsgkimsgfdanrfftgdwylthsrdsevpvrcekyqtgsnlqlnfng
    kngdvkcsgstvsgnqgfysfqctttsggsftsymavvetdyanyallyrcglagsttpk
    dnfllfnrqssgeipaglstklnqleltslnklgcs
    

    Sequence, based on observed residues (ATOM records):
    >5h9nA (A:)
    vtsiptgcnalsgkimsgfdanrfftgdwylthsrdsevpvrcekyqtgsnlqlnfngkn
    gdvkcsgstvsgnqgfysfqctttsggsftsymavvetdyanyallyrcglagsttpkdn
    fllfnrqssgeipaglstklnqleltslnklgcs