PDB entry 5h9k

View 5h9k on RCSB PDB site
Description: crystal of a leukotriene-binding salivary lipocalin
Deposited on 2015-12-28, released 2016-05-11
The last revision was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipocalin AI-4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h9kA (A:)
    aevtsiptgcnalsgkimsgfdanrfftgdwylthsrdsevpvrcekyqtgsnlqlnfng
    kngdvkcsgstvsgnqgfysfqctttsggsftsymavvetdyanyallyrcglygsttpk
    dnfllfnrqssgeipaglstklnqleltslnklgcs
    

    Sequence, based on observed residues (ATOM records):
    >5h9kA (A:)
    vtsiptgcnalsgkimsgfdanrfftgdwylthsrdsevpvrcekyqtgsnlqlnfngkn
    gdvkcsgstvsgnqgfysfqctttsggsftsymavvetdyanyallyrcglygsttpkdn
    fllfnrqssgeipaglstklnqleltslnklgcs