PDB entry 5h9b

View 5h9b on RCSB PDB site
Description: Drosophila CaMKII-wt in complex with a fragment of the Eag potassium channel and Mg2+/AMPPN
Class: transferase
Keywords: protein kinase, potassium channel, complex, transferase
Deposited on 2015-12-27, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase II, isoform C
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CaMKII, CaMKII-RA, CG18069, Dmel_CG18069
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h9ba_
  • Chain 'B':
    Compound: Potassium voltage-gated channel protein eag
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: eag, CG10952
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AN2, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h9bA (A:)
    gamaapaactrfsdnydikeelgkgafsivkrcvqkstgfefaakiintkkltardfqkl
    erearicrklhhpnivrlhdsiqeenyhylvfdlvtggelfedivarefyseadashciq
    qilesvnhchqngvvhrdlkpenlllaskakgaavkladfglaievqgdhqawfgfagtp
    gylspevlkkepygksvdiwacgvilyillvgyppfwdedqhrlysqikagaydypspew
    dtvtpeaknlinqmltvnpnkritaaealkhpwicqrervasvvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h9bA (A:)
    ctrfsdnydikeelgkgafsivkrcvqkstgfefaakiintkkltardfqklerearicr
    klhhpnivrlhdsiqeenyhylvfdlvtggelfedivarefyseadashciqqilesvnh
    chqngvvhrdlkpenlllaskakgaavkladfglaievqgdhqawfgfagtpgylspevl
    kkepygksvdiwacgvilyillvgyppfwdedqhrlysqikagaydypspewdtvtpeak
    nlinqmltvnpnkritaaealkhpwicqr
    

  • Chain 'B':
    No sequence available.