PDB entry 5h93

View 5h93 on RCSB PDB site
Description: crystal structure of geobacter metallireducens smug1
Deposited on 2015-12-25, released 2016-04-27
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geobacter metallireducens SMUG1
    Species: Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) [TaxId:269799]
    Gene: Gmet_0095
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Geobacter metallireducens SMUG1
    Species: Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) [TaxId:269799]
    Gene: Gmet_0095
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Geobacter metallireducens SMUG1
    Species: Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) [TaxId:269799]
    Gene: Gmet_0095
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Geobacter metallireducens SMUG1
    Species: Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) [TaxId:269799]
    Gene: Gmet_0095
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h93A (A:)
    gphmtglaaisdalaadlaglsfsspvahvynpllyarephvaylsrfgsppkevlfvgm
    npgpwgmaqtgvpfgevavvtewlgingtvtrpagehpkkrvdgfacrrsevsgrrlwgf
    irerfgtperffarffvanycpllfltaeggnitpdklrrgeqeplfaacdlalrrtvvl
    lrprvvigvgafaearchealegfdvevgriihpspaspaanrdwagtalrqlaelgvdf
    

    Sequence, based on observed residues (ATOM records):
    >5h93A (A:)
    glaaisdalaadlaglsfsspvahvynpllyarephvaylsrfgsppkevlfvgmnpgpw
    gmaqtgvpfgevavvtewlgingtvtrpagehpkkrvdgfacrrsevsgrrlwgfirerf
    gtperffarffvanycpllfltaeggnitpdklrrgeqeplfaacdlalrrtvvllrprv
    vigvgafaearchealegfdvevgriihpspasanrdwagtalrqlaelgvdf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h93B (B:)
    gphmtglaaisdalaadlaglsfsspvahvynpllyarephvaylsrfgsppkevlfvgm
    npgpwgmaqtgvpfgevavvtewlgingtvtrpagehpkkrvdgfacrrsevsgrrlwgf
    irerfgtperffarffvanycpllfltaeggnitpdklrrgeqeplfaacdlalrrtvvl
    lrprvvigvgafaearchealegfdvevgriihpspaspaanrdwagtalrqlaelgvdf
    

    Sequence, based on observed residues (ATOM records):
    >5h93B (B:)
    tglaaisdalaadlaglsfsspvahvynpllyarephvaylsrfgsppkevlfvgmnpgp
    wgmaqtgvpfgevavvtewlgingtvtrpagehpkkrvdgfacrrsevsgrrlwgfirer
    fgtperffarffvanycpllfltaeggnitpdklrrgeqeplfaacdlalrrtvvllrpr
    vvigvgafaearchealegfdvevgriihpspaspdwagtalrqlaelgvdf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h93C (C:)
    gphmtglaaisdalaadlaglsfsspvahvynpllyarephvaylsrfgsppkevlfvgm
    npgpwgmaqtgvpfgevavvtewlgingtvtrpagehpkkrvdgfacrrsevsgrrlwgf
    irerfgtperffarffvanycpllfltaeggnitpdklrrgeqeplfaacdlalrrtvvl
    lrprvvigvgafaearchealegfdvevgriihpspaspaanrdwagtalrqlaelgvdf
    

    Sequence, based on observed residues (ATOM records):
    >5h93C (C:)
    glaaisdalaadlaglsfsspvahvynpllyarephvaylsrfgsppkevlfvgmnpgpw
    gmaqtgvpfgevavvtewlgingtvtrpagehpkkrvdgfacrrsevsgrrlwgfirerf
    gtperffarffvanycpllfltaeggnitpdklrrgeqeplfaacdlalrrtvvllrprv
    vigvgafaearchealegfdvevgriihpspnrdwagtalrqlaelgvdf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5h93D (D:)
    gphmtglaaisdalaadlaglsfsspvahvynpllyarephvaylsrfgsppkevlfvgm
    npgpwgmaqtgvpfgevavvtewlgingtvtrpagehpkkrvdgfacrrsevsgrrlwgf
    irerfgtperffarffvanycpllfltaeggnitpdklrrgeqeplfaacdlalrrtvvl
    lrprvvigvgafaearchealegfdvevgriihpspaspaanrdwagtalrqlaelgvdf
    

    Sequence, based on observed residues (ATOM records):
    >5h93D (D:)
    tglaaisdalaadlaglsfsspvahvynpllyarephvaylsrfgsppkevlfvgmnpgp
    wgmaqtgvpfgevavvtewlgingtvtrpagehpkkrvdgfacrrsevsgrrlwgfirer
    fgtperffarffvanycpllfltaeggnitpdklrrgeqeplfaacdlalrrtvvllrpr
    vvigvgafaearchealegfdvevgriihpspaspaanrdwagtalrqlaelgvdf