PDB entry 5h8w

View 5h8w on RCSB PDB site
Description: xpd mechanism
Deposited on 2015-12-24, released 2016-01-13
The last revision was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent DNA helicase ta0057
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0057
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HM14 (Start-596)
      • engineered mutation (287)
      • engineered mutation (310)
      • engineered mutation (344)
      • engineered mutation (523)
      • engineered mutation (559)
  • Chain 'E':
    Compound: DNA (5'-d(p*tp*ap*cp*gp*a)-3')
    Species: Escherichia coli, synthetic [TaxId:562]
  • Heterogens: SF4, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h8wA (A:)
    mqksygvalesptgsgktimalksalqysserklkvlylvrtnsqeeqvikelrslsstm
    kiraipmqgrvnmcilyrmvddlheinaeslakfcnmkkrevmagneaacpyfnfkirsd
    etkrflfdelptaeefydygernnvcpyesmkaalpdadiviapyayflnrsvaekflsh
    wgvsrnqiviildeahnlpdigrsigsfrisveslnradreaqaygdpelsqkihvsdli
    emirsalqsmvsercgkgdvrirfqefmeymrimnkrsereirsllnalylfgeyvenek
    ekvgkvpfsyassvasriiafsdqdeekyaailspedggymqaaaldpsgilevlkeskt
    ihmsgtldpfdfysditgfeipfkkigeifppenryiayydgvsskydtldekeldrmat
    viediilkvkkntivyfpsyslmdrvenrvsfehmkeyrgidqkelysmlkkfrrdhgti
    favsggrlseginfpgnelemiilaglpfprpdainrslfdyycrkygkgweysvvypta
    ikirqeigrlirsaedtgaavildkragqfrkfipdmkktsdpasdiynffisaqar
    

    Sequence, based on observed residues (ATOM records):
    >5h8wA (A:)
    qksygvalesptgsgktimalksalqysserklkvlylvrtnsqeeqvikelrslsstmk
    iraipmqgrvnmcilyrmvddlheinaeslakfcnmkkrevmagneaacpyfnfkirsde
    tkrflfdelptaeefydygernnvcpyesmkaalpdadiviapyayflnrsvaekflshw
    gvsrnqiviildeahnlpdigrsigsfrisveslnradreaqaygdpelsqkihvsdlie
    mirsalqsmvsercgkgdvrirfqefmeymrimnkrsereirsllnalylfgeyveneke
    kvgkvpfsyassvasriiafsdqdeekyaailspedggymqaaaldpsgilevlkeskti
    hmsgtldpfdfysditgfeipfkkigeifppenryiayydgvsskydtldekeldrmatv
    iediilkvkkntivyfpsyslmdrvenrvsfehmkeyrgidqkelysmlkkfrrdhgtif
    avsggrlseginfpgnelemiilaglpfprpdainrslfdyycrkygkgweysvvyptai
    kirqeigrlirsaedtgaavildkragqfrkfipdmkktsdpasdiynffisaqar
    

  • Chain 'E':
    No sequence available.