PDB entry 5h8u

View 5h8u on RCSB PDB site
Description: Crystal structure of mycobacterium tuberculosis wild-type malate synthase in complex with product malate
Class: transferase
Keywords: transferase
Deposited on 2015-12-23, released 2016-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: glcB, Rv1837c, MTCY1A11.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8ua_
  • Chain 'B':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: glcB, Rv1837c, MTCY1A11.06
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8ub_
  • Heterogens: MG, LMR, GLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h8uA (A:)
    mtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardel
    qaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvp
    vlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsv
    plssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhie
    ilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdla
    aavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfe
    gimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvl
    glpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrk
    gtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragasta
    wvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdn
    ncqsilgyvvrwvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvra
    slermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrre
    fkaraaekpapsdragddaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8uA (A:)
    drvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelqa
    qidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvl
    narfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvpl
    ssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieil
    idpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaaa
    vaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalf
    tgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntm
    kigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqp
    wilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpspta
    atlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilg
    yvvrwvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermap
    lvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h8uB (B:)
    mtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardel
    qaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvp
    vlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsv
    plssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhie
    ilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdla
    aavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfe
    gimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvl
    glpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrk
    gtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragasta
    wvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdn
    ncqsilgyvvrwvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvra
    slermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrre
    fkaraaekpapsdragddaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8uB (B:)
    drvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelqa
    qidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvl
    narfalnaanarwgslydalygtdvipetekgptynkvrgdkviayarkflddsvplssg
    sfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilidp
    esqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaaavfl
    rvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgli
    aihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigi
    mdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwila
    yedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlh
    alhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvr
    wvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdr
    qnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae