PDB entry 5h8n

View 5h8n on RCSB PDB site
Description: Structure of the human GluN1/GluN2A LBD in complex with NAM
Class: transport protein
Keywords: GluN1, GluN2A, NMDA, receptor, TRANSPORT PROTEIN
Deposited on 2015-12-23, released 2016-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor ionotropic, NMDA 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: GRIN2A, NMDAR2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12879 (Start-140)
      • linker (141-142)
    • Uniprot Q12879 (143-End)
    Domains in SCOPe 2.08: d5h8na_
  • Chain 'B':
    Compound: Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ionotropic, NMDA 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Grin1, Nmdar1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05586 (Start-152)
      • linker (153-154)
    • Uniprot Q05586 (155-End)
    Domains in SCOPe 2.08: d5h8nb_
  • Heterogens: GLU, 5YD, CA, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h8nA (A:)
    gspddnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckg
    fcidilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineer
    sevvdfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnn
    ypymhqymtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifa
    ttgygialqkgspwkrqidlallqfvgdgemeeletlwltgichn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8nA (A:)
    nhlsivtleeapfvivedidpetcvrntvpcrkfvkinnstnegmnvkkcckgfcidilk
    klsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdfs
    vpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhqy
    mtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygia
    lqkgspwkrqidlallqfvgdgemeeletlwltgic
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h8nB (B:)
    gsmstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtv
    pqccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqad
    mivapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqs
    svdiyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlv
    ttgelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8nB (B:)
    trlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqcc
    ygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivaplt
    inneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiyfr
    rqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgelff
    rsgfgigmrkdspwkqnvslsilkshengfmedldktwvryq