PDB entry 5h8l

View 5h8l on RCSB PDB site
Description: Crystal structure of Medicago truncatula N-carbamoylputrescine amidohydrolase (MtCPA) C158S mutant in complex with putrescine
Class: hydrolase
Keywords: amidase, helical octamer, alpha-beta-beta-alpha sandwich fold, HYDROLASE
Deposited on 2015-12-23, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8la_
  • Chain 'B':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lb_
  • Chain 'C':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (3-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lc_
  • Chain 'D':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8ld_
  • Chain 'E':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8le_
  • Chain 'F':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lf_
  • Chain 'G':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lg_
  • Chain 'H':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lh_
  • Chain 'I':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8li_
  • Chain 'J':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lj_
  • Chain 'K':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (3-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lk_
  • Chain 'L':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8ll_
  • Chain 'M':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lm_
  • Chain 'N':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8ln_
  • Chain 'O':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5 (Start-303)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lo_
  • Chain 'P':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7ITU5
      • engineered mutation (160)
    Domains in SCOPe 2.07: d5h8lp_
  • Heterogens: GOL, EDO, PUT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h8lA (A:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lA (A:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptai
    gsepqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiagpt
    geivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h8lB (B:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lB (B:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h8lC (C:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lC (C:)
    maedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqr
    edfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyr
    kshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfy
    ptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygns
    fiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv
    l
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5h8lD (D:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lD (D:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5h8lE (E:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lE (E:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptai
    gsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiag
    ptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5h8lF (F:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lF (F:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5h8lG (G:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lG (G:)
    rkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfiqr
    akpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshipd
    gpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptaigs
    ephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiagpt
    geivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5h8lH (H:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lH (H:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptaigsed
    srdhwkrvmqghaganlvplvasnrigneiietseikfygnsfiagptgeivsiaddkee
    avliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5h8lI (I:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lI (I:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfypta
    igsepdsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiagptge
    ivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5h8lJ (J:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lJ (J:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5h8lK (K:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lK (K:)
    maedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqr
    edfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyr
    kshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfy
    ptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygns
    fiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv
    l
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5h8lL (L:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lL (L:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5h8lM (M:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lM (M:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptai
    gsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiag
    ptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5h8lN (N:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lN (N:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5h8lO (O:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lO (O:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptai
    gsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiag
    ptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5h8lP (P:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8lP (P:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pdgyeekfyfnpgdtgfkvfqtkyakigvaiswdqwfpeaaramalqgaeilfyptaigs
    epidsrdhwkrvmqghaganlvplvasnrigneiietkseikfygnsfiagptgeivsia
    ddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv