PDB entry 5h8j

View 5h8j on RCSB PDB site
Description: Crystal structure of Medicago truncatula N-carbamoylputrescine amidohydrolase (MtCPA) in complex with cadaverine
Class: hydrolase
Keywords: amidase, helical octamer, alpha-beta-beta-alpha sandwich fold, putrescine biosynthesis, HYDROLASE
Deposited on 2015-12-23, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8ja_
  • Chain 'B':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jb_
  • Chain 'C':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jc_
  • Chain 'D':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jd_
  • Chain 'E':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8je_
  • Chain 'F':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jf_
  • Chain 'G':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jg_
  • Chain 'H':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jh_
  • Chain 'I':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8ji_
  • Chain 'J':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jj_
  • Chain 'K':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jk_
  • Chain 'L':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jl_
  • Chain 'M':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jm_
  • Chain 'N':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jn_
  • Chain 'O':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jo_
  • Chain 'P':
    Compound: N-carbamoylputrescine amidohydrolase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_2g086600
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h8jp_
  • Heterogens: GOL, PEG, EDO, N2P, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h8jA (A:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jA (A:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfyptai
    gsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiag
    ptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h8jB (B:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jB (B:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfyptai
    gsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiag
    ptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h8jC (C:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jC (C:)
    maedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqr
    edfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyr
    kshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfy
    ptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygns
    fiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv
    l
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5h8jD (D:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jD (D:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5h8jE (E:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jE (E:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfyptai
    gsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiag
    ptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5h8jF (F:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jF (F:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5h8jG (G:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jG (G:)
    rkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfiqr
    akpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshipd
    gpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfyptaigs
    ephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiagpt
    geivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5h8jH (H:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jH (H:)
    kgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredfi
    qrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrkshi
    pfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfyptaigdsrdhwk
    rvmqghaganlvplvasnriseikfygnsfiagptgeivsiaddkeeavliaefnldkik
    smrhcwgvfrdrrpdlykvlltldgknp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5h8jI (I:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jI (I:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfypta
    igsedsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfiagptgei
    vsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5h8jJ (J:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jJ (J:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5h8jK (K:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jK (K:)
    maedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqr
    edfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyr
    kshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfy
    ptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygns
    fiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv
    l
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5h8jL (L:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jL (L:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5h8jM (M:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jM (M:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5h8jN (N:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jN (N:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5h8jO (O:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jO (O:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfypta
    igsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfygnsfia
    gptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpvl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5h8jP (P:)
    snamaedkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcq
    aqredfiqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlg
    iyrkshipdgpgyeekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaei
    lfyptaigsephdqsidsrdhwkrvmqghaganlvplvasnrigneiietehgkseikfy
    gnsfiagptgeivsiaddkeeavliaefnldkiksmrhcwgvfrdrrpdlykvlltldgk
    npvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h8jP (P:)
    dkgrkvvvsalqfactddvstnvttaerlvraahkqganivliqelfegyyfcqaqredf
    iqrakpykdhptimrlqklakelgvvipvsffeeannahynsiaiidadgtdlgiyrksh
    ipekfyfnpgdtgfkvfqtkyakigvaicwdqwfpeaaramalqgaeilfyptaigsdsr
    dhwkrvmqghaganlvplvasnrigneiikseikfygnsfiagptgeivsiaddkeeavl
    iaefnldkiksmrhcwgvfrdrrpdlykvlltldgknpv