PDB entry 5h8d

View 5h8d on RCSB PDB site
Description: Crystal structure of an ASC binding nanobody
Class: immune system
Keywords: VHH nanobody, ASC-binding, antibody fragment, inflammasome, IMMUNE SYSTEM
Deposited on 2015-12-23, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VHH nanobody
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H8D (0-113)
    Domains in SCOPe 2.07: d5h8da1, d5h8da2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h8dA (A:)
    qvqlqesggglvqpggslklscaasgftfsryamswyrqapgkeresvarissgggtiyy
    adsvkgrftisredakntvylqmnslkpedtavyycyvggfwgqgtqvtvssgg