PDB entry 5h8c

View 5h8c on RCSB PDB site
Description: truncated xpd
Deposited on 2015-12-23, released 2016-01-13
The last revision was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: XPD/Rad3 related DNA helicase
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene: SacN8_00920
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h8cA (A:)
    mvklrdwqeklkdkvieglrnnflvalnaptgsgktlfsllvslevkpkvlfvvrthnef
    ypiyrdltkirekrnitfsflvgkpssclyaekgaesedipckycelkgsivevktddsp
    lslvkklkkdglqdkfcpyysllnslykadvialtypyffidryrefididlreymivid
    eahnldkvneleerslseitiqmaikqskseesrrilskllnqlrevvlpdekyikvenv
    pklskeeleiladdyedirkdslkqgkvnkihigsilrffsllsigsfipfsyskrlvik
    npeisyylnllndnelsiilmsgtlppreymekvwgikrnmlyldvereiqkrvsgsyec
    yigvdvtskydmrsdnmwkryadyllkiyfqakanvlvvfpsyeimdrvmsrislpkyve
    sedssvedlysaisannkvligsvgkgklaegielrnndrslisdvvivgipypppddyl
    kilaqrvslkmnreneeflfkipalvtikqaigrairdvndkcnvwlldkrfeslywkkn
    lkclnankmkl
    

    Sequence, based on observed residues (ATOM records):
    >5h8cA (A:)
    qeklkdkvieglrnnflvalnaptgsgktlfsllvslevkpkvlfvvrthnefypiyrdl
    tkirekrnitfsflvgkpssclyaekgaesedipckycelkgsivevktddsplslvkkl
    kkdglqdkfcpyysllnslykadvialtypyffidryrefididlreymivideahnldk
    vneleerslseitiqmaikqskseesrrilskllnqlrevvlpdekyikvenvpklskee
    leiladdyedirkdslkqgkvnkihigsilrffsllfipfsyskrlviknpeisyylnll
    ndnelsiilmsgtlppreymekvwgikrnmlyldv