PDB entry 5h87

View 5h87 on RCSB PDB site
Description: Crystal structure of mRojoA mutant - P63H - W143S
Class: fluorescent protein
Keywords: quantum yield, protein engineering, FLUORESCENT PROTEIN
Deposited on 2015-12-23, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRojoA fluorescent protein
    Species: Discosoma sp. [TaxId:86600]
    Gene: PAmCherry
    Database cross-references and differences (RAF-indexed):
    • PDB 5H87
    Domains in SCOPe 2.07: d5h87a_
  • Chain 'B':
    Compound: mRojoA fluorescent protein
    Species: Discosoma sp. [TaxId:86600]
    Gene: PAmCherry
    Database cross-references and differences (RAF-indexed):
    • PDB 5H87
    Domains in SCOPe 2.07: d5h87b_
  • Chain 'C':
    Compound: mRojoA fluorescent protein
    Species: Discosoma sp. [TaxId:86600]
    Gene: PAmCherry
    Database cross-references and differences (RAF-indexed):
    • PDB 5H87
    Domains in SCOPe 2.07: d5h87c_
  • Chain 'D':
    Compound: mRojoA fluorescent protein
    Species: Discosoma sp. [TaxId:86600]
    Gene: PAmCherry
    Database cross-references and differences (RAF-indexed):
    • PDB 5H87
    Domains in SCOPe 2.07: d5h87d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h87A (A:)
    mghhhhhhgvskgeednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklk
    vtkggplpfawdilshqfmygskayvkhpadipdylklsfpegfkwervmnfedggvvtv
    tqdsslqdgefiykvklhgtnfpsdgpvmqkktmgseassermypedgalkgeiklrlkl
    kdgghydaevkttykakkpvqlpgaynanyklditshnedytiveqyercegrhstggmd
    elyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h87A (A:)
    iikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilshqfm
    ygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklhg
    tnfpsdgpvmqkktmgseassermypedgalkgeiklrlklkdgghydaevkttykakkp
    vqlpgaynanyklditshnedytiveqyercegrhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h87B (B:)
    mghhhhhhgvskgeednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklk
    vtkggplpfawdilshqfmygskayvkhpadipdylklsfpegfkwervmnfedggvvtv
    tqdsslqdgefiykvklhgtnfpsdgpvmqkktmgseassermypedgalkgeiklrlkl
    kdgghydaevkttykakkpvqlpgaynanyklditshnedytiveqyercegrhstggmd
    elyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h87B (B:)
    iikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilshqfm
    ygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklhg
    tnfpsdgpvmqkktmgseassermypedgalkgeiklrlklkdgghydaevkttykakkp
    vqlpgaynanyklditshnedytiveqyercegrhs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h87C (C:)
    mghhhhhhgvskgeednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklk
    vtkggplpfawdilshqfmygskayvkhpadipdylklsfpegfkwervmnfedggvvtv
    tqdsslqdgefiykvklhgtnfpsdgpvmqkktmgseassermypedgalkgeiklrlkl
    kdgghydaevkttykakkpvqlpgaynanyklditshnedytiveqyercegrhstggmd
    elyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h87C (C:)
    iikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilshqfm
    ygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklhg
    tnfpsdgpvmqkktmgseassermypedgalkgeiklrlklkdgghydaevkttykakkp
    vqlpgaynanyklditshnedytiveqyercegrhs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5h87D (D:)
    mghhhhhhgvskgeednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklk
    vtkggplpfawdilshqfmygskayvkhpadipdylklsfpegfkwervmnfedggvvtv
    tqdsslqdgefiykvklhgtnfpsdgpvmqkktmgseassermypedgalkgeiklrlkl
    kdgghydaevkttykakkpvqlpgaynanyklditshnedytiveqyercegrhstggmd
    elyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h87D (D:)
    iikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilshqfm
    ygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklhg
    tnfpsdgpvmqkktmgseassermypedgalkgeiklrlklkdgghydaevkttykakkp
    vqlpgaynanyklditshnedytiveqyercegrhs