PDB entry 5h7x

View 5h7x on RCSB PDB site
Description: Crystal structure of the complex of Phosphopantetheine adenylyltransferase from Acinetobacter baumannii with 2-hydroxy-1,2,3-propane tricarboxylate at 1.76 A resolution
Class: transferase
Keywords: transferase
Deposited on 2016-11-21, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h7xa_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h7xb_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h7xc_
  • Chain 'D':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h7xd_
  • Chain 'E':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h7xe1, d5h7xe2
  • Chain 'F':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h7xf1, d5h7xf2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h7xA (A:)
    glvprgshmsktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleer
    valaqsslghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldp
    hfeavfltpseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h7xA (A:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h7xB (B:)
    glvprgshmsktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleer
    valaqsslghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldp
    hfeavfltpseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h7xB (B:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h7xC (C:)
    glvprgshmsktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleer
    valaqsslghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldp
    hfeavfltpseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h7xC (C:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5h7xD (D:)
    glvprgshmsktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleer
    valaqsslghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldp
    hfeavfltpseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h7xD (D:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h7xE (E:)
    glvprgshmsktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleer
    valaqsslghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldp
    hfeavfltpseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h7xF (F:)
    glvprgshmsktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleer
    valaqsslghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldp
    hfeavfltpseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw