PDB entry 5h7q

View 5h7q on RCSB PDB site
Description: crystal structure of human mnda pyd domain with mbp tag
Deposited on 2016-11-20, released 2017-02-15
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MNDA PYD domain with MBP tag
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H7Q
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h7qA (A:)
    mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsa
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvda
    alaaaqtnaarafaaaeykkilllkgfelmddyhftsiksllaydlglttkmqeeynrik
    itdlmekkfqgvacldklielakdmpslknlvnnlrkekskvakkiktqeklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5h7qA (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsav
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
    laaaqtnaarafaaaeykkilllkgfelmddyhftsiksllaydlglttkmqeeynriki
    tdlmekkfqgvacldklielakdmpslknlvnnlrkekskvakkiktqe