PDB entry 5h7c

View 5h7c on RCSB PDB site
Description: crystal structure of a repeat protein with two protein a-dhr14 repeat modules
Deposited on 2016-11-17, released 2017-06-28
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein A, DHR14
    Species: synthetic construct, synthetic [TaxId:32630]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507 (4-56)
    • PDB 5H7C (57-203)
    • Uniprot P38507 (204-252)
      • engineered mutation (29)
      • engineered mutation (50)
      • engineered mutation (53-54)
      • engineered mutation (207)
      • engineered mutation (214)
      • engineered mutation (225)
      • engineered mutation (246)
      • engineered mutation (249-250)
    • PDB 5H7C (253-403)
  • Chain 'C':
    Compound: Immunoglobulin G-binding protein A, DHR14
    Species: synthetic construct, synthetic [TaxId:32630]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507 (Start-56)
    • PDB 5H7C (57-203)
    • Uniprot P38507 (204-252)
      • engineered mutation (29)
      • engineered mutation (50)
      • engineered mutation (53-54)
      • engineered mutation (207)
      • engineered mutation (214)
      • engineered mutation (225)
      • engineered mutation (246)
      • engineered mutation (249-250)
    • PDB 5H7C (253-403)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h7cA (A:)
    gshmkfnkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakslnvnqavkq
    laekakeatdkeevieivkelaelakqstdselvneivkqlaevakeatdkelviyivki
    laelakqstdselvneivkqlaevakeatdkelviyivkilaelakqstdselvneivkq
    leevakeatdkelvehiekileeleqqsafyeilslpnlneeqrnafiqslkddpsqsan
    llaeakslnvnqavkqlaekakeatdkeevieivkelaelakqstdselvneivkqlaev
    akeatdkelviyivkilaelakqstdselvneivkqlaevakeatdkelviyivkilael
    akqstdselvneivkqleevakeatdkelvehiekileelkkqs
    

    Sequence, based on observed residues (ATOM records):
    >5h7cA (A:)
    kfnkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakslnvnqavkqlaek
    akeatdkeevieivkelaelakqstdselvneivkqlaevakeatdkelviyivkilael
    akqstdselvneivkqlaevakeatdkelviyivkilaelakqstdselvneivkqleev
    akeatdkelvehiekileeleqqsafyeilslpnlneeqrnafiqslkddpsqsanllae
    akslnvnqavkqlaekakeatdkeevieivkelaelakqstdselvneivkqlaevakea
    tdkelviyivkilaelakqstdselvneivkqlaevakeatdkelviyivkilaelakqs
    tdselvneivkqleevakeatdkelvehiekileelkkqs
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h7cC (C:)
    gshmkfnkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakslnvnqavkq
    laekakeatdkeevieivkelaelakqstdselvneivkqlaevakeatdkelviyivki
    laelakqstdselvneivkqlaevakeatdkelviyivkilaelakqstdselvneivkq
    leevakeatdkelvehiekileeleqqsafyeilslpnlneeqrnafiqslkddpsqsan
    llaeakslnvnqavkqlaekakeatdkeevieivkelaelakqstdselvneivkqlaev
    akeatdkelviyivkilaelakqstdselvneivkqlaevakeatdkelviyivkilael
    akqstdselvneivkqleevakeatdkelvehiekileelkkqs
    

    Sequence, based on observed residues (ATOM records):
    >5h7cC (C:)
    keqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakslnvnqavkqlaekake
    atdkeevieivkelaelakqstdselvneivkqlaevakeatdkelviyivkilaelakq
    stdselvneivkqlaevakeatdkelviyivkilaelakqstdselvneivkqleevake
    atdkelvehiekileeleqqsafyeilslpnlneeqrnafiqslkddpsqsanllaeaks
    lnvnqavkqlaekakeatdkeevieivkelaelakqstdselvneivkqlaevakeatdk
    elviyivkilaelakqstdselvneivkqlaevakeatdkelviyivkilaelakqstds
    elvneivkqleevakeatdkelvehiekileelkkqs