PDB entry 5h79

View 5h79 on RCSB PDB site
Description: Crystal structure of a repeat protein with three Protein A repeat module
Class: immune system
Keywords: synthetic protein, IMMUNE SYSTEM
Deposited on 2016-11-17, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507 (4-50)
      • engineered mutation (27)
    • Uniprot P38507 (51-95)
      • engineered mutation (54)
      • engineered mutation (61)
      • engineered mutation (72)
    • Uniprot P38507 (96-End)
      • engineered mutation (99)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d5h79c1, d5h79c2, d5h79c3
  • Chain 'D':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507 (4-50)
      • engineered mutation (27)
    • Uniprot P38507 (51-95)
      • engineered mutation (54)
      • engineered mutation (61)
      • engineered mutation (72)
    • Uniprot P38507 (96-145)
      • engineered mutation (99)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d5h79d1, d5h79d2, d5h79d3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h79C (C:)
    gshmnkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqaafyei
    lslpnlneeqrnafiqslkddpsqsanllaeakklneqqaafyeilhlpnlneeqrnafi
    qslkddpsqsanllaeakklndaqap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h79C (C:)
    nkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqaafyeilslp
    nlneeqrnafiqslkddpsqsanllaeakklneqqaafyeilhlpnlneeqrnafiqslk
    ddpsqsanllaeakklndaqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5h79D (D:)
    gshmnkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqaafyei
    lslpnlneeqrnafiqslkddpsqsanllaeakklneqqaafyeilhlpnlneeqrnafi
    qslkddpsqsanllaeakklndaqap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h79D (D:)
    nkeqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqaafyeilslp
    nlneeqrnafiqslkddpsqsanllaeakklneqqaafyeilhlpnlneeqrnafiqslk
    ddpsqsanllaeakklndaqap