PDB entry 5h75

View 5h75 on RCSB PDB site
Description: crystal structure of the mrsd-protein a fusion protein
Deposited on 2016-11-17, released 2017-06-28
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mersacidin decarboxylase,Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RC23 (Start-190)
      • engineered mutation (188)
    • Uniprot P38507 (191-End)
      • engineered mutation (208)
  • Chain 'B':
    Compound: Mersacidin decarboxylase,Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RC23 (Start-190)
      • engineered mutation (188)
    • Uniprot P38507 (191-End)
      • engineered mutation (208)
  • Chain 'C':
    Compound: Mersacidin decarboxylase,Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RC23 (Start-190)
      • engineered mutation (188)
    • Uniprot P38507 (191-End)
      • engineered mutation (208)
  • Chain 'D':
    Compound: Mersacidin decarboxylase,Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RC23 (7-190)
      • expression tag (3-6)
      • engineered mutation (188)
    • Uniprot P38507 (191-End)
      • engineered mutation (208)
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h75A (A:)
    gsggggsmsisilkdkklligicgsissvgissyllyfksffkeirvvmtktaedlipah
    tvsyfcdhvysehgengkrhshveigrwadiyciipatanilgqtangvamnlvattvla
    hphntiffpnmndlmwnktvvsrnieqlrkdghiviepveimafeiatgtrkpnrglitp
    dkallaieqgfafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records):
    >5h75A (A:)
    dkklligicgsissvgissyllyfksffkeirvvmtktaedlipahtvsyfcdhvysehe
    igrwadiyciipatanilgqtangvamnlvattvlahphntiffpnmndlmwnktvvsrn
    ieqlrkdghiviepveimafeiatgtrkpnrglitpdkallaieqgfafyeilhlpnlne
    eqrnafiqslkddpsqsanllaeakklndaqa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h75B (B:)
    gsggggsmsisilkdkklligicgsissvgissyllyfksffkeirvvmtktaedlipah
    tvsyfcdhvysehgengkrhshveigrwadiyciipatanilgqtangvamnlvattvla
    hphntiffpnmndlmwnktvvsrnieqlrkdghiviepveimafeiatgtrkpnrglitp
    dkallaieqgfafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records):
    >5h75B (B:)
    kdkklligicgsissvgissyllyfksffkeirvvmtktaedlipahtvsyfcdhvyseh
    eigrwadiyciipatanilgqtangvamnlvattvlahphntiffpnmndlmwnktvvsr
    nieqlrkdghiviepveirglitpdkallaieqgfafyeilhlpnlneeqrnafiqslkd
    dpsqsanllaeakklndaqa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h75C (C:)
    gsggggsmsisilkdkklligicgsissvgissyllyfksffkeirvvmtktaedlipah
    tvsyfcdhvysehgengkrhshveigrwadiyciipatanilgqtangvamnlvattvla
    hphntiffpnmndlmwnktvvsrnieqlrkdghiviepveimafeiatgtrkpnrglitp
    dkallaieqgfafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records):
    >5h75C (C:)
    ilkdkklligicgsissvgissyllyfksffkeirvvmtktaedlipahtvsyfcdhvys
    eheigrwadiyciipatanilgqtangvamnlvattvlahphntiffpnmndlmwnktvv
    srnieqlrkdghiviepveirglitpdkallaieqgfafyeilhlpnlneeqrnafiqsl
    kddpsqsanllaeakklndaqa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5h75D (D:)
    gsggggsmsisilkdkklligicgsissvgissyllyfksffkeirvvmtktaedlipah
    tvsyfcdhvysehgengkrhshveigrwadiyciipatanilgqtangvamnlvattvla
    hphntiffpnmndlmwnktvvsrnieqlrkdghiviepveimafeiatgtrkpnrglitp
    dkallaieqgfafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklndaqapk
    

    Sequence, based on observed residues (ATOM records):
    >5h75D (D:)
    gggsmsisilkdkklligicgsissvgissyllyfksffkeirvvmtktaedlipahtvs
    yfcdhvysehhveigrwadiyciipatanilgqtangvamnlvattvlahphntiffpnm
    ndlmwnktvvsrnieqlrkdghiviepveimafeiatgtrkpnrglitpdkallaieqgf
    afyeilhlpnlneeqrnafiqslkddpsqsanllaeakklndaqa