PDB entry 5h6z

View 5h6z on RCSB PDB site
Description: Crystal structure of Set7, a novel histone methyltransferase in Schizossacharomyces pombe
Class: transcription
Keywords: Histone, methytransferase, Schizosaccharomyces pombe SET7, Epigenetic, TRANSCRIPTION
Deposited on 2016-11-15, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SET domain-containing protein 7
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: set7, SPCC297.04c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h6za_
  • Chain 'B':
    Compound: SET domain-containing protein 7
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: set7, SPCC297.04c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y7Q6 (6-End)
      • see sequence details (0-5)
    Domains in SCOPe 2.07: d5h6zb1, d5h6zb2
  • Heterogens: SO4, NH4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h6zA (A:)
    aghmtsmripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqyt
    vlneytyvwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcis
    ygdhlwfedeassasrispneenedfplqnislletmypydvpdyaapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h6zA (A:)
    ripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqytvlneyty
    vwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcisygdhlwf
    ede
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h6zB (B:)
    aghmtsmripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqyt
    vlneytyvwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcis
    ygdhlwfedeassasrispneenedfplqnislletmypydvpdyaapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h6zB (B:)
    aghmtsmripvirspleirdterkgrgvfalepipaqtcieispvlmfskeeyeqhgqyt
    vlneytyvwsegkqglalglgsmfnhdrhpnvywkkdnrnnyisyytlreiktneelcis