PDB entry 5h6n

View 5h6n on RCSB PDB site
Description: dna targeting adp-ribosyltransferase pierisin-1, autoinhibitory form
Deposited on 2016-11-14, released 2017-08-09
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pierisin-1
    Species: Pieris rapae [TaxId:64459]
    Database cross-references and differences (RAF-indexed):
    • Uniprot H3JU00
      • engineered mutation (172)
  • Chain 'B':
    Compound: Pierisin-1
    Species: Pieris rapae [TaxId:64459]
    Database cross-references and differences (RAF-indexed):
    • Uniprot H3JU00
      • engineered mutation (172)
  • Chain 'C':
    Compound: Pierisin-1
    Species: Pieris rapae [TaxId:64459]
    Database cross-references and differences (RAF-indexed):
    • Uniprot H3JU00
      • engineered mutation (172)
  • Chain 'D':
    Compound: Pierisin-1
    Species: Pieris rapae [TaxId:64459]
    Database cross-references and differences (RAF-indexed):
    • Uniprot H3JU00
      • engineered mutation (172)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h6nA (A:)
    gplgspefmadrqpymtngiqaavvewiraldleiislllsrawpmallatselrwrptv
    ltdtdnvvrldrrqrlvrwdrrppneifldgfvpivtrenpdweetdlygfaknnhpsif
    vsttktqrnkkkyvwtprnanrgivyqyeiyapggvdvndsfsdaspwpnqmqvafpggi
    qniyirsarelhngriqriwinpnfldpgdlepivsssrtpqviwrmnhpdgghrdqrse
    rsassyddlmyggtgnvqedtfgdepnnpkpiaag
    

    Sequence, based on observed residues (ATOM records):
    >5h6nA (A:)
    pymtngiqaavvewiraldleiislllsrawpmallatselrwrptvltdtdnvvrldrr
    qrlvrwdrrppneifldgfvpivtrenpdweetdlygfaknnhpsifvsttktqrnkkky
    vwtprnanrgivyqyeiyapggvdvndsfsdaspwpnqmqvafpggiqniyirsarelhn
    griqriwinpnfldpgdlepivsssrtpqviwrmnhpdgghrdqrddlmyggtgnvqedt
    fgd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h6nB (B:)
    gplgspefmadrqpymtngiqaavvewiraldleiislllsrawpmallatselrwrptv
    ltdtdnvvrldrrqrlvrwdrrppneifldgfvpivtrenpdweetdlygfaknnhpsif
    vsttktqrnkkkyvwtprnanrgivyqyeiyapggvdvndsfsdaspwpnqmqvafpggi
    qniyirsarelhngriqriwinpnfldpgdlepivsssrtpqviwrmnhpdgghrdqrse
    rsassyddlmyggtgnvqedtfgdepnnpkpiaag
    

    Sequence, based on observed residues (ATOM records):
    >5h6nB (B:)
    pymtngiqaavvewiraldleiislllsrawpmallatselrwrptvltdtdnvvrldrr
    qrlvrwdrrppneifldgfvpivtrenpdweetdlygfaknnhpsifvsttktqrnkkky
    vwtprnanrgivyqyeiyapggvdvndsfsdaspwpnqmqvafpggiqniyirsarelhn
    griqriwinpnfldpgdlepirtpqviwrmnhpdgghrdqrddlmyggtgnvqedtfgd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h6nC (C:)
    gplgspefmadrqpymtngiqaavvewiraldleiislllsrawpmallatselrwrptv
    ltdtdnvvrldrrqrlvrwdrrppneifldgfvpivtrenpdweetdlygfaknnhpsif
    vsttktqrnkkkyvwtprnanrgivyqyeiyapggvdvndsfsdaspwpnqmqvafpggi
    qniyirsarelhngriqriwinpnfldpgdlepivsssrtpqviwrmnhpdgghrdqrse
    rsassyddlmyggtgnvqedtfgdepnnpkpiaag
    

    Sequence, based on observed residues (ATOM records):
    >5h6nC (C:)
    pymtngiqaavvewiraldleiislllsrawpmallatselrwrptvltdtdnvvrldrr
    qrlvrwdrrppneifldgfvpivtrenpdweetdlygfaknnhpsifvsttktqrnkkky
    vwtprnanrgivyqyeiyapggvdvndsfsdaspwpnqmqvafpggiqniyirsarelhn
    griqriwinpnfldpgdlepivrtpqviwrmnhpdgghrdqrsersddlmyggtgnvqed
    tf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5h6nD (D:)
    gplgspefmadrqpymtngiqaavvewiraldleiislllsrawpmallatselrwrptv
    ltdtdnvvrldrrqrlvrwdrrppneifldgfvpivtrenpdweetdlygfaknnhpsif
    vsttktqrnkkkyvwtprnanrgivyqyeiyapggvdvndsfsdaspwpnqmqvafpggi
    qniyirsarelhngriqriwinpnfldpgdlepivsssrtpqviwrmnhpdgghrdqrse
    rsassyddlmyggtgnvqedtfgdepnnpkpiaag
    

    Sequence, based on observed residues (ATOM records):
    >5h6nD (D:)
    pymtngiqaavvewiraldleiislllsrawpmallatselrwrptvltdtdnvvrldrr
    qrlvrwdrrppneifldgfvpivtrenpdweetdlygfaknnhpsifvsttktqrnkkky
    vwtprnanrgivyqyeiyapggvdvndsfsdaspwpnqmqvafpggiqniyirsarelhn
    griqriwinpnfldpgdlepivsrtpqviwrmnhpdgghrdddlmyggtgnvqedtfgd