PDB entry 5h6g

View 5h6g on RCSB PDB site
Description: crystal structure of a thermostable lipase from marine streptomyces
Deposited on 2016-11-11, released 2017-09-20
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative secreted lipase
    Species: Streptomyces sp. W007 [TaxId:1055352]
    Gene: SPW_1544
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative secreted lipase
    Species: Streptomyces sp. W007 [TaxId:1055352]
    Gene: SPW_1544
    Database cross-references and differences (RAF-indexed):
    • Uniprot H0B8D4 (Start-264)
      • expression tag (265)
  • Chain 'C':
    Compound: Putative secreted lipase
    Species: Streptomyces sp. W007 [TaxId:1055352]
    Gene: SPW_1544
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, CL, K, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h6gA (A:)
    atataatpaaeatsrgwndysckpsaahprpvvlvhgtfgnsidnwlvlapylvnrgycv
    fsldygqlpgvpffhglgpidksaeqldvfvdkvldatgapkadlvghsqggmmpnyylk
    flggadkvnalvgiapdnhgttllgltkllpffpgvekfisdntpgladqvagspfitkl
    taggdtvpgvrytviatkydqvvtpyrtqyldgpnvrnvllqdlcpvdlsehvaigtidr
    iafhevanaldparatpttcasvighhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5h6gA (A:)
    tsrgwndysckpsaahprpvvlvhgtfgnsidnwlvlapylvnrgycvfsldygqlpgvp
    ffhglgpidksaeqldvfvdkvldatgapkadlvghsqggmmpnyylkflggadkvnalv
    giapdnhgttllgltkllpffpgvekfisdntpgladqvagspfitkltaggdtvpgvry
    tviatkydqvvtpyrtqyldgpnvrnvllqdlcpvdlsehvaigtidriafhevanaldp
    aratpttcasvig
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h6gB (B:)
    atataatpaaeatsrgwndysckpsaahprpvvlvhgtfgnsidnwlvlapylvnrgycv
    fsldygqlpgvpffhglgpidksaeqldvfvdkvldatgapkadlvghsqggmmpnyylk
    flggadkvnalvgiapdnhgttllgltkllpffpgvekfisdntpgladqvagspfitkl
    taggdtvpgvrytviatkydqvvtpyrtqyldgpnvrnvllqdlcpvdlsehvaigtidr
    iafhevanaldparatpttcasvighhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5h6gB (B:)
    tsrgwndysckpsaahprpvvlvhgtfgnsidnwlvlapylvnrgycvfsldygqlpgvp
    ffhglgpidksaeqldvfvdkvldatgapkadlvghsqggmmpnyylkflggadkvnalv
    giapdnhgttllgltkllpffpgvekfisdntpgladqvagspfitkltaggdtvpgvry
    tviatkydqvvtpyrtqyldgpnvrnvllqdlcpvdlsehvaigtidriafhevanaldp
    aratpttcasvigh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h6gC (C:)
    atataatpaaeatsrgwndysckpsaahprpvvlvhgtfgnsidnwlvlapylvnrgycv
    fsldygqlpgvpffhglgpidksaeqldvfvdkvldatgapkadlvghsqggmmpnyylk
    flggadkvnalvgiapdnhgttllgltkllpffpgvekfisdntpgladqvagspfitkl
    taggdtvpgvrytviatkydqvvtpyrtqyldgpnvrnvllqdlcpvdlsehvaigtidr
    iafhevanaldparatpttcasvighhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5h6gC (C:)
    tsrgwndysckpsaahprpvvlvhgtfgnsidnwlvlapylvnrgycvfsldygqlpgvp
    ffhglgpidksaeqldvfvdkvldatgapkadlvghsqggmmpnyylkflggadkvnalv
    giapdnhgttllgltkllpffpgvekfisdntpgladqvagspfitkltaggdtvpgvry
    tviatkydqvvtpyrtqyldgpnvrnvllqdlcpvdlsehvaigtidriafhevanaldp
    aratpttcasvig