PDB entry 5h63

View 5h63 on RCSB PDB site
Description: structure of transferase mutant-c23s,c199s
Deposited on 2016-11-10, released 2017-12-20
The last revision was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H63 (Start-347)
  • Chain 'B':
    Compound: Transferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H63 (Start-347)
  • Chain 'C':
    Compound: Transferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H63
  • Chain 'D':
    Compound: Transferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H63
  • Heterogens: UD1, MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h63A (A:)
    marfnaaftrikimfsrirgliscqsntqtiaptlsppssghvsfagidypllplnhqtp
    lvfqwfernpdrfgqneipiintqknpylnniinaaiiekeriigifvdgdfskgqrkal
    gkleqnyrnikviynsdlnysmydkklttiylenitkleaqsaserdevllngvkksled
    vlknnpeetlisshnkdkghlwfdfyrnlfllkgsdafleagkpgchhlqpgggciylda
    dmlltdklgtlylpdgiaihvsrkdnhvslengiiavnrsehpalikgleimhskpygdp
    yndwlskglrhyfdgshiqdydafcdfiefkheniimntssltasswr
    

    Sequence, based on observed residues (ATOM records):
    >5h63A (A:)
    sghvsfagidypllplnhqtplvfqwfernpdrfgqneipiintqknpylnniinaaiie
    keriigifvdgdfskgqrkalgkleqnyrnikviynsdlnysmydkklttiylenitkle
    aqsaserdevllngvkksledvlknnpeetlisshnkdkghlwfdfyrnlfllkgsdafl
    eagkpgchhlqpgggciyldadmlltdklgtlylpdgiaihvsrkdnhvslengiiavnr
    sehpalikgleimhskpygdpyndwlskglrhyfdgshiqdydafcdfiefkheniimnt
    ssltasswr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h63B (B:)
    marfnaaftrikimfsrirgliscqsntqtiaptlsppssghvsfagidypllplnhqtp
    lvfqwfernpdrfgqneipiintqknpylnniinaaiiekeriigifvdgdfskgqrkal
    gkleqnyrnikviynsdlnysmydkklttiylenitkleaqsaserdevllngvkksled
    vlknnpeetlisshnkdkghlwfdfyrnlfllkgsdafleagkpgchhlqpgggciylda
    dmlltdklgtlylpdgiaihvsrkdnhvslengiiavnrsehpalikgleimhskpygdp
    yndwlskglrhyfdgshiqdydafcdfiefkheniimntssltasswr
    

    Sequence, based on observed residues (ATOM records):
    >5h63B (B:)
    sghvsfagidypllplnhqtplvfqwfernpdrfgqneipiintqknpylnniinaaiie
    keriigifvdgdfskgqrkalgkleqnyrnikviynsdlnysmydkklttiylenitkle
    aqsaserdevllngvkksledvlknnpeetlisshnkdkghlwfdfyrnlfllkgsdafl
    eagkpgchhlqpgggciyldadmlltdklgtlylpdgiaihvsrkdnhvslengiiavnr
    sehpalikgleimhskpygdpyndwlskglrhyfdgshiqdydafcdfiefkheniimnt
    ssltasswr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h63C (C:)
    marfnaaftrikimfsrirgliscqsntqtiaptlsppssghvsfagidypllplnhqtp
    lvfqwfernpdrfgqneipiintqknpylnniinaaiiekeriigifvdgdfskgqrkal
    gkleqnyrnikviynsdlnysmydkklttiylenitkleaqsaserdevllngvkksled
    vlknnpeetlisshnkdkghlwfdfyrnlfllkgsdafleagkpgchhlqpgggciylda
    dmlltdklgtlylpdgiaihvsrkdnhvslengiiavnrsehpalikgleimhskpygdp
    yndwlskglrhyfdgshiqdydafcdfiefkheniimntssltasswr
    

    Sequence, based on observed residues (ATOM records):
    >5h63C (C:)
    ghvsfagidypllplnhqtplvfqwfernpdrfgqneipiintqknpylnniinaaiiek
    eriigifvdgdfskgqrkalgkleqnyrnikviynsdlnysmydkklttiylenitklea
    qsaserdevllngvkksledvlknnpeetlisshnkdkghlwfdfyrnlfllkgsdafle
    agkpgchhlqpgggciyldadmlltdklgtlylpdgiaihvsrkdnhvslengiiavnrs
    ehpalikgleimhskpygdpyndwlskglrhyfdgshiqdydafcdfiefkheniimnts
    sl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5h63D (D:)
    marfnaaftrikimfsrirgliscqsntqtiaptlsppssghvsfagidypllplnhqtp
    lvfqwfernpdrfgqneipiintqknpylnniinaaiiekeriigifvdgdfskgqrkal
    gkleqnyrnikviynsdlnysmydkklttiylenitkleaqsaserdevllngvkksled
    vlknnpeetlisshnkdkghlwfdfyrnlfllkgsdafleagkpgchhlqpgggciylda
    dmlltdklgtlylpdgiaihvsrkdnhvslengiiavnrsehpalikgleimhskpygdp
    yndwlskglrhyfdgshiqdydafcdfiefkheniimntssltasswr
    

    Sequence, based on observed residues (ATOM records):
    >5h63D (D:)
    ghvsfagidypllplnhqtplvfqwfernpdrfgqneipiintqknpylnniinaaiiek
    eriigifvdgdfskgqrkalgkleqnyrnikviynsdlnysmydkklttiylenitklea
    qsaserdevllngvkksledvlknnpeetlisshnkdkghlwfdfyrnlfllkgsdafle
    agkpgchhlqpgggciyldadmlltdklgtlylpdgiaihvsrkdnhvslengiiavnrs
    ehpalikgleimhskpygdpyndwlskglrhyfdgshiqdydafcdfiefkheniimnts
    sl