PDB entry 5h5x

View 5h5x on RCSB PDB site
Description: Crystal structure of NADH bound carbonyl reductase from Streptomyces coelicolor
Class: oxidoreductase
Keywords: Carbonyl reductase, SDR family, COBE reductase, oxidoreductase
Deposited on 2016-11-10, released 2017-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xa_
  • Chain 'B':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xb_
  • Chain 'C':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xc_
  • Chain 'D':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xd_
  • Chain 'E':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xe_
  • Chain 'F':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xf_
  • Chain 'G':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xg_
  • Chain 'H':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xh_
  • Chain 'I':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xi_
  • Chain 'J':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xj_
  • Chain 'K':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xk_
  • Chain 'L':
    Compound: Putative oxidoreductase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO7363
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYM4 (Start-262)
      • conflict (211)
      • conflict (231)
      • conflict (238)
    Domains in SCOPe 2.06: d5h5xl_
  • Heterogens: NAI, IPA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h5xA (A:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xA (A:)
    tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea
    aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld
    gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa
    rgirinavgpgfidtmeeaaykglvalhpagrlgrsdevaelivfllsdrasfvagsyhl
    vdgaytav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h5xB (B:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xB (B:)
    tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea
    aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld
    gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa
    rgirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivfllsdrasfva
    gsyhlvdgaytav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h5xC (C:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xC (C:)
    tpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelrag
    gveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvr
    tnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaa
    eyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivfllsdra
    sfvagsyhlvdgaytav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5h5xD (D:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xD (D:)
    tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea
    aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld
    gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa
    rgirinavgpgfidtktmeeaaykglvalhpagrlgrsdevaelivfllsdrasfvagsy
    hlvdgaytav
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5h5xE (E:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xE (E:)
    tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea
    aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld
    gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa
    rgirinavgpgfidtpeeaaykglvalhpagrlgrsdevaelivfllsdrasfvagsyhl
    vdgaytav
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5h5xF (F:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xF (F:)
    tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea
    aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld
    gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa
    rgirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivfllsdrasfva
    gsyhlvdgaytav
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5h5xG (G:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xG (G:)
    tpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelrag
    gveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvr
    tnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaa
    eyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivfllsdra
    sfvagsyhlvdgaytav
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5h5xH (H:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xH (H:)
    tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea
    aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld
    gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa
    rgirinavgpgfidtplktmeeaaykglvalhpagrlgrsdevaelivfllsdrasfvag
    syhlvdgaytav
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5h5xI (I:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xI (I:)
    tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea
    aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld
    gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa
    rgirinavgpgfidtykglvalhpagrlgrsdevaelivfllsdrasfvagsyhlvdgay
    tav
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5h5xJ (J:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xJ (J:)
    tgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggvea
    aaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnld
    gvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaa
    rgirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivfllsdrasfva
    gsyhlvdgaytav
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5h5xK (K:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xK (K:)
    tpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelrag
    gveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvr
    tnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaa
    eyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivfllsdra
    sfvagsyhlvdgaytav
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5h5xL (L:)
    msttgttpattgyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaa
    aelraggveaaaveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaa
    yqrvvrtnldgvfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgl
    tkaaaaeyaargirinavgpgfidtpllktmeeaaykglvalhpagrlgrsdevaelivf
    llsdrasfvagsyhlvdgaytav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5xL (L:)
    gyaaefagrtalvtgaasgiglatarrlgaggarvvvadfnaegaekaaaelraggveaa
    aveldvtrpesveaavgfavdtfgsldlavnnagiggpsaptgeydvaayqrvvrtnldg
    vfysmryelpaieaagkggsivnvasilgsvgfagspayvaakhgvvgltkaaaaeyaar
    girinavgpgfidteeaaykglvalhpagrlgrsdevaelivfllsdrasfvagsyhlvd
    gaytav