PDB entry 5h5g

View 5h5g on RCSB PDB site
Description: Staphylococcus aureus FtsZ-GDP in T and R states
Class: cell cycle
Keywords: Tubulin/FtsZ family, GTPase, protofilament, CELL CYCLE
Deposited on 2016-11-05, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus (strain MRSA252) [TaxId:282458]
    Gene: ftsZ, SAR1162
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GHP9 (3-307)
      • expression tag (2)
    Domains in SCOPe 2.07: d5h5ga1, d5h5ga2, d5h5ga3
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus (strain MRSA252) [TaxId:282458]
    Gene: ftsZ, SAR1162
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GHP9 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5h5gb1, d5h5gb2, d5h5gb3
  • Heterogens: GDP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h5gA (A:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5gA (A:)
    matlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglg
    aganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvg
    vvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvl
    rqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaisspll
    etsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtv
    iatgfd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h5gB (B:)
    ghmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrg
    lgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgalt
    vgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadn
    vlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissp
    lletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivv
    tviatgfd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h5gB (B:)
    hmatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrgl
    gaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltv
    gvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnv
    lrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaisspl
    letsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvt
    viatgf