PDB entry 5h5c

View 5h5c on RCSB PDB site
Description: mdm12 from k. lactis (1-239), uniformly lys dimethyl modified, crystallized in fos-mea-10
Deposited on 2016-11-05, released 2017-11-08
The last revision was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 3.31 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial distribution and morphology protein 12
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Gene: MDM12, KLLA0C06028g
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6CUC3 (1-End)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h5cA (A:)
    hmsveidwdnirgdlsvnqgvkdflnsrlqefelpsyvnnlkvtnfdlgtmppnvilkqm
    ddpldefysyllqegdiskeaakdkntdvqllveldykgdmsielsadlvlnypspqfmi
    lpvklrisdigmhclcllaylkkqlfisflcdvsdpllendklqvdpsgpnfmgkraler
    islirnikihtelgqldqgegsvlrsvgkleeflvdlfrnlirkeaawpswidldftped
    

    Sequence, based on observed residues (ATOM records):
    >5h5cA (A:)
    hmsveidwdnirgdlsvnqgvkdflnsrlqefelpsyvnnlkvtnfdlgtmppnvilkqm
    ddpldefysdvqllveldykgdmsielsadllpvklrisdigmhclcllaylkkqlfisf
    lcdvsdpllendklqvdpsnfmgkralerislirnikihtellrsvgkleeflvdlfrnl
    irkeaawpswidld