PDB entry 5h55

View 5h55 on RCSB PDB site
Description: mdm12 from k. lactis
Deposited on 2016-11-04, released 2017-11-08
The last revision was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial distribution and morphology protein 12
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Gene: MDM12, KLLA0C06028g
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h55A (A:)
    mgsshhhhhhssglvprgshmsveidwdnirgdlsvnqgvkdflnsrlqefelpsyvnnl
    kvtnfdlgtmppnvilkqmddpldefysyllqegdiskeaakdkntdvqllveldykgdm
    sielsadlvlnypspqfmilpvklrisdigmhclcllaylkkqlfisflcdvsdpllend
    klqvdpsgpnfmgkralerislirnikihtelgqldqgegsvlrsvgkleeflvdlfrnl
    irkeaawpswidldftpedpedpeeegrendlvadssndgkdiemksgteetlgagiqes
    vqhvspavtsidqesrvnsntslee
    

    Sequence, based on observed residues (ATOM records):
    >5h55A (A:)
    msveidwdnirgdlsvnqgvkdflnsrlqefelpsyvnnlkvtnfdlgtmppnvilkqmd
    dpldefysyntdvqllveldykgdmsielsadlvqfmilpvklrisdigmhclcllaylk
    kqlfisflcdvsdpllendklqvdpsgpnfmgkralerislirnikihtegegsvlrsvg
    kleeflvdlfrnlirkeaawpswidld