PDB entry 5h4z

View 5h4z on RCSB PDB site
Description: Crystal structure of S202G mutant of human SYT-5 C2A domain
Class: metal binding protein
Keywords: metal binding protein, mutant
Deposited on 2016-11-02, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00445
      • engineered mutation (18)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d5h4za_
  • Chain 'B':
    Compound: Synaptotagmin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00445
      • engineered mutation (18)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d5h4zb_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h4zA (A:)
    mghhhhhhmqvadkhelgqlqysldydfqsgqllvgilqamglaaldlggssdpyvrvyl
    lpdkrrryetkvhrqtlnphfgetfafkvpyvelggrvlvmavydfdrfgrndaigevrv
    pmssvdlgrpvqawrelqaapreeqeklgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h4zA (A:)
    dkhelgqlqysldydfqsgqllvgilqamglaaldlggssdpyvrvyllpdkrrryetkv
    hrqtlnphfgetfafkvpyvelggrvlvmavydfdrfgrndaigevrvpmssvdlgrpvq
    awrelqaap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h4zB (B:)
    mghhhhhhmqvadkhelgqlqysldydfqsgqllvgilqamglaaldlggssdpyvrvyl
    lpdkrrryetkvhrqtlnphfgetfafkvpyvelggrvlvmavydfdrfgrndaigevrv
    pmssvdlgrpvqawrelqaapreeqeklgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h4zB (B:)
    khelgqlqysldydfqsgqllvgilqamglaaldlggssdpyvrvyllpdkrrryetkvh
    rqtlnphfgetfafkvpyvelggrvlvmavydfdrfgrndaigevrvpmssvdlgrpvqa
    wrelqaap