PDB entry 5h4i

View 5h4i on RCSB PDB site
Description: Unlinked NS2B-NS3 Protease from Zika Virus in complex with a compound fragment
Class: viral protein
Keywords: zika virus protease, serine protease, non-structural protein 3, viral protein
Deposited on 2016-10-31, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS2B cofactor
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H4I
    Domains in SCOPe 2.07: d5h4ia_
  • Chain 'B':
    Compound: NS3 protease
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H4I
    Domains in SCOPe 2.07: d5h4ib_
  • Heterogens: 7HQ, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h4iA (A:)
    mtgksvdmyieragditwekdaevtgnsprldvaldesgdfslveddgppmre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h4iA (A:)
    dmyieragditwekdaevtgnsprldvaldesgdfslv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h4iB (B:)
    gsgalwdvpapkevkkgettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalr
    sgegrldpywgdvkqdlvsycgpwkldaawdglsevqllavppgerakniqtlpgifktk
    dgdigavaldypagtsgspildkcgrviglygngvvikngsyvsaitqgkreeetpve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h4iB (B:)
    ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
    vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
    spildkcgrviglygngvvikngsyvsaitqgkre