PDB entry 5h46

View 5h46 on RCSB PDB site
Description: Mycobacterium smegmatis Dps1 mutant - F47E
Class: oxidoreductase
Keywords: Structural switch, Mutational tipping point, Point mutant, Oligomerisation, OXIDOREDUCTASE
Deposited on 2016-10-31, released 2017-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: dps, MSMEG_6467, MSMEI_6295
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0R692 (0-148)
      • engineered mutation (38)
    Domains in SCOPe 2.07: d5h46a_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h46A (A:)
    lsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpneigvhemidpqvelvrgyadev
    aeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekle
    dldlvsqdlliahagelekfqwfvrahle