PDB entry 5h45

View 5h45 on RCSB PDB site
Description: crystal structure of the c-terminal lon protease-like domain of thermus thermophilus rada/sms
Deposited on 2016-10-30, released 2017-05-03
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein RadA
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: radA, TTHA0541
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA repair protein RadA
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: radA, TTHA0541
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h45A (A:)
    mgsshhhhhhssgenlyfqghmseaflkerplgvpgsavalalageralalevqalaakt
    pfpaprrvvqgldgrrvdvvlavlerrlglplanldvyvnlagglkvqdpgldlavalav
    ysavvgrplpadlalvgevglagevrrvaglerrlregeragfgrflhpgnlkrlqeave
    ayla
    

    Sequence, based on observed residues (ATOM records):
    >5h45A (A:)
    gvpgsavalalageralalevqalaaktpfpaprrvvqgldgrrvdvvlavlerrlglpl
    anldvyvnlagglkvqdpgldlavalavysavvgrplpadlalvgevglagevrrvagle
    rrlregeragfgrflhpgnlkrlqeaveayla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h45B (B:)
    mgsshhhhhhssgenlyfqghmseaflkerplgvpgsavalalageralalevqalaakt
    pfpaprrvvqgldgrrvdvvlavlerrlglplanldvyvnlagglkvqdpgldlavalav
    ysavvgrplpadlalvgevglagevrrvaglerrlregeragfgrflhpgnlkrlqeave
    ayla
    

    Sequence, based on observed residues (ATOM records):
    >5h45B (B:)
    kerplgvpgsavalalageralalevqalaaktpfpaprrvvqgldgrrvdvvlavlerr
    lglplanldvyvnlagglkvqdpgldlavalavysavvgrplpadlalvgevglagevrr
    vaglerrlregeragfgrflhpgnlkrlqeaveayla