PDB entry 5h3z

View 5h3z on RCSB PDB site
Description: crystal structure of 1,2-beta-oligoglucan phosphorylase from lachnoclostridium phytofermentans
Deposited on 2016-10-28, released 2017-03-01
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Clostridium phytofermentans ISDg [TaxId:357809]
    Gene: Cphy_0694
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9KJS6 (2-1113)
      • expression tag (1)
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Clostridium phytofermentans ISDg [TaxId:357809]
    Gene: Cphy_0694
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9KJS6 (2-1113)
      • expression tag (1)
  • Heterogens: GOL, CA, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h3zA (A:)
    mgilktlsapiilensnstftflpggdnfewihesiminafqgntldgstnnlylriykd
    nslafypligmnskstiksgtstlifegtaedisytvtfrltpygiwfwdislsgncnka
    diiysqdigvgtkgsvnsnelylaqylghsifqgdygyvicsrqnmaqgdlfpylqqgsl
    girsiaystdgtqffglsykktnipealygdlpsknkqyelahtalqteafslsgtkqfs
    fygicktnhpevireieyiqelekayayhesgeilpvnvptlqnigapyassrwdakqve
    hyfpkrlleekeeeallsfftpekshvvlqdkeltterphghilmtnfdvtkvpqgvvss
    tnymygafncqfvvgnttynkllsnhrgllniqkdsgqrifikigdcyrqltlpaayemn
    vagstwyyqldedvliitsfamynrpeivlkvqslghkkydfivthqltvgpneyeneik
    ltregnilqlsptdpvvtnhfypelsfrmripedctlsddsiffhnnttinpsllsieil
    qkssfdivmqgfdtgnvipfldqydykeqleayriyydqlvcnfklsapdkiplsaekln
    aiihwyahdalihfasphgleqsggaawgtrdvcqgpiefflttghfdlvrhilitlysh
    qieggfewpqwfmfdhypihqedchgdvvfwplkaisdyiqatgdtsilnelvdyrtakd
    alptnqpetilihikravttiknrylsgtalisyaggdwddtlqpanselkenlvsawtq
    alaeqtlellcsaikgidhdfskelshmandirtsfyqylikdgviagflyreseehmky
    mlhpddtessihyrllpltrsiiaqladfklatrnleiidehlacpdgvrlmdhpasysg
    giskiflraeqaanvgreislqyvhahiryiealatmglskkawdalmrinpilltdyvp
    naltrqsnvyfsssegcfddryeyaknfdklrtgdinvkggwrlyssgpgiyirriiadl
    lgirfghnvihidpvvtkeldgvtlqftcfgktvfftyhvddtmdkhicvksnnnilpgd
    nlnniyrdggiqiakdvflsaamsdnnfhiyvknlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5h3zA (A:)
    gilktlsapiilensnstftflpggdnfewihesiminafqgntldgstnnlylriykdn
    slafypligmnskstiksgtstlifegtaedisytvtfrltpygiwfwdislsgncnkad
    iiysqdigvgtkgsvnsnelylaqylghsifqgdygyvicsrqnmaqgdlfpylqqgslg
    irsiaystdgtqffglsykktnipealygdlpsknkqyelahtalqteafslsgtkqfsf
    ygicktnhpevireieyiqelekayayhesgeilpvnvptlqnigapyassrwdakqveh
    yfpkrlleekeeeallsfftpekshvvlqdkeltterphghilmtnfdvtkvpqgvvsst
    nymygafncqfvvgnttynkllsnhrgllniqkdsgqrifikigdcyrqltlpaayemnv
    agstwyyqldedvliitsfamynrpeivlkvqslghkkydfivthqltvgpneyeneikl
    tregnilqlsptdpvvtnhfypelsfrmripedctlsddsiffhnnttinpsllsieilq
    kssfdivmqgfdtgnvipfldqydykeqleayriyydqlvcnfklsapdkiplsaeklna
    iihwyahdalihfasphgleqsggaawgtrdvcqgpiefflttghfdlvrhilitlyshq
    ieggfewpqwfmfdhypihqedchgdvvfwplkaisdyiqatgdtsilnelvdyrtakda
    lptnqpetilihikravttiknrylsgtalisyaggdwddtlqpanselkenlvsawtqa
    laeqtlellcsaikgidhdfskelshmandirtsfyqylikdgviagflyreseehmkym
    lhpddtessihyrllpltrsiiaqladfklatrnleiidehlacpdgvrlmdhpasysgg
    iskiflraeqaanvgreislqyvhahiryiealatmglskkawdalmrinpilltdyvpn
    altrqsnvyfsssegcfddryeyaknfdklrtgdinvkggwrlyssgpgiyirriiadll
    girfghnvihidpvvtkeldgvtlqftcfgktvfftyhvddtmdkhicvksnnnilpgdn
    lnniyrdggiqiakdvflsaamsdnnfhiyvkn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h3zB (B:)
    mgilktlsapiilensnstftflpggdnfewihesiminafqgntldgstnnlylriykd
    nslafypligmnskstiksgtstlifegtaedisytvtfrltpygiwfwdislsgncnka
    diiysqdigvgtkgsvnsnelylaqylghsifqgdygyvicsrqnmaqgdlfpylqqgsl
    girsiaystdgtqffglsykktnipealygdlpsknkqyelahtalqteafslsgtkqfs
    fygicktnhpevireieyiqelekayayhesgeilpvnvptlqnigapyassrwdakqve
    hyfpkrlleekeeeallsfftpekshvvlqdkeltterphghilmtnfdvtkvpqgvvss
    tnymygafncqfvvgnttynkllsnhrgllniqkdsgqrifikigdcyrqltlpaayemn
    vagstwyyqldedvliitsfamynrpeivlkvqslghkkydfivthqltvgpneyeneik
    ltregnilqlsptdpvvtnhfypelsfrmripedctlsddsiffhnnttinpsllsieil
    qkssfdivmqgfdtgnvipfldqydykeqleayriyydqlvcnfklsapdkiplsaekln
    aiihwyahdalihfasphgleqsggaawgtrdvcqgpiefflttghfdlvrhilitlysh
    qieggfewpqwfmfdhypihqedchgdvvfwplkaisdyiqatgdtsilnelvdyrtakd
    alptnqpetilihikravttiknrylsgtalisyaggdwddtlqpanselkenlvsawtq
    alaeqtlellcsaikgidhdfskelshmandirtsfyqylikdgviagflyreseehmky
    mlhpddtessihyrllpltrsiiaqladfklatrnleiidehlacpdgvrlmdhpasysg
    giskiflraeqaanvgreislqyvhahiryiealatmglskkawdalmrinpilltdyvp
    naltrqsnvyfsssegcfddryeyaknfdklrtgdinvkggwrlyssgpgiyirriiadl
    lgirfghnvihidpvvtkeldgvtlqftcfgktvfftyhvddtmdkhicvksnnnilpgd
    nlnniyrdggiqiakdvflsaamsdnnfhiyvknlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5h3zB (B:)
    gilktlsapiilensnstftflpggdnfewihesiminafqgntldgstnnlylriykdn
    slafypligmnskstiksgtstlifegtaedisytvtfrltpygiwfwdislsgncnkad
    iiysqdigvgtkgsvnsnelylaqylghsifqgdygyvicsrqnmaqgdlfpylqqgslg
    irsiaystdgtqffglsykktnipealygdlpsknkqyelahtalqteafslsgtkqfsf
    ygicktnhpevireieyiqelekayayhesgeilpvnvptlqnigapyassrwdakqveh
    yfpkrlleekeeeallsfftpekshvvlqdkeltterphghilmtnfdvtkvpqgvvsst
    nymygafncqfvvgnttynkllsnhrgllniqkdsgqrifikigdcyrqltlpaayemnv
    agstwyyqldedvliitsfamynrpeivlkvqslghkkydfivthqltvgpneyeneikl
    tregnilqlsptdpvvtnhfypelsfrmripedctlsddsiffhnnttinpsllsieilq
    kssfdivmqgfdtgnvipfldqydykeqleayriyydqlvcnfklsapdkiplsaeklna
    iihwyahdalihfasphgleqsggaawgtrdvcqgpiefflttghfdlvrhilitlyshq
    ieggfewpqwfmfdhypihqedchgdvvfwplkaisdyiqatgdtsilnelvdyrtakda
    lptnqpetilihikravttiknrylsgtalisyaggdwddtlqpanselkenlvsawtqa
    laeqtlellcsaikgidhdfskelshmandirtsfyqylikdgviagflyreseehmkym
    lhpddtessihyrllpltrsiiaqladfklatrnleiidehlacpdgvrlmdhpasysgg
    iskiflraeqaanvgreislqyvhahiryiealatmglskkawdalmrinpilltdyvpn
    altrqsnvyfsssegcfddryeyaknfdklrtgdinvkggwrlyssgpgiyirriiadll
    girfghnvihidpvvtkeldgvtlqftcfgktvfftyhvddtmdkhicvksnnnilpgdn
    lnniyrdggiqiakdvflsaamsdnnfhiyvkn