PDB entry 5h3w

View 5h3w on RCSB PDB site
Description: the structure of the c-terminal of the fibronectin/fibrinogen-binding protein from streptococcus suis (fbps)
Deposited on 2016-10-27, released 2016-11-16
The last revision was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin/fibrinogen binding protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Gene: fbps
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Fibronectin/fibrinogen binding protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Gene: fbps
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RP86 (0-281)
      • engineered mutation (47)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h3wA (A:)
    drvaqqanelikrvaseleknrkklikqeqeladtetaelvrqkgellttyvhqvpndqs
    svrldnyytgkeleieldvaltpsqnaqryfkkyqklkeavkhltnlieetkstivyles
    vdtmlgqaslaeideireelietgylkrrhrekihkrqkperylatdgktiilvgknnlq
    ndeltfkmakkgelwfhakdipgshvvitdnldpsdevktdaaelaayfskarhsnlvqv
    dmieakklhkptggkpgfvtyrgqktlrvtptedkiksmki
    

    Sequence, based on observed residues (ATOM records):
    >5h3wA (A:)
    drvaqqanelikrvaseleknrkklikqeqeladtetaelvrqkgellsqnaqryfkkyq
    klkeavkhltnlieetkstivylesvdtmlgqaslaeideireelietgylkrrhrekih
    krqkperylatdgktiilvgknnlqndeltfkmakkgelwfhakdipgshvvitdnldps
    devktdaaelaayfskarhsnlvqvdmieakklhkptggkpgfvtyrgqktlrvtptedk
    iksmki
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h3wB (B:)
    rdrvaqqanelikrvaseleknrkklikqeqeladtetaelvrqkgeilttyvhqvpndq
    ssvrldnyytgkeleieldvaltpsqnaqryfkkyqklkeavkhltnlieetkstivyle
    svdtmlgqaslaeideireelietgylkrrhrekihkrqkperylatdgktiilvgknnl
    qndeltfkmakkgelwfhakdipgshvvitdnldpsdevktdaaelaayfskarhsnlvq
    vdmieakklhkptggkpgfvtyrgqktlrvtptedkiksmki
    

    Sequence, based on observed residues (ATOM records):
    >5h3wB (B:)
    rdrvaqqanelikrvaseleknrkklikqeqeladtetaelvrqkgeilttsqnaqryfk
    kyqklkeavkhltnlieetkstivylesvdtmlgqaslaeideireelietgylkrrhre
    kihkrqkperylatdgktiilvgknnlqndeltfkmakkgelwfhakdipgshvvitdnl
    dpsdevktdaaelaayfskarhsnlvqvdmieakklhkptggkpgfvtyrgqktlrvtpt
    edkiksmki