PDB entry 5h3v

View 5h3v on RCSB PDB site
Description: crystal structure of a type iv secretion system component cagx in helicobacter pylori
Deposited on 2016-10-27, released 2017-04-12
The last revision was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cag8
    Species: Helicobacter pylori [TaxId:210]
    Gene: cag8, wsv002
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cag8
    Species: Helicobacter pylori [TaxId:210]
    Gene: cag8, wsv002
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IPA, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5h3vA (A:)
    pvprnynyyqapekrskhimpseifddgtftyfgfknitlqpaifvvqpdgklsmtdaai
    dpnmtnsglrwyrvneiaekfklikdkalvtvinkgygknplt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5h3vB (B:)
    pvprnynyyqapekrskhimpseifddgtftyfgfknitlqpaifvvqpdgklsmtdaai
    dpnmtnsglrwyrvneiaekfklikdkalvtvinkgygknplt