PDB entry 5h3t

View 5h3t on RCSB PDB site
Description: m7g cap bound to gemin5-wd
Deposited on 2016-10-27, released 2016-12-28
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gem-associated protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Gem-associated protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN5
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Gem-associated protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN5
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Gem-associated protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN5
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MGT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h3tA (A:)
    mgqeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigel
    vghtervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwspr
    vkdlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviid
    iskkgevihrlrghddeihsiawcplpgedclsinqeetseeaeitngnavaqapvtkgc
    ylatgskdqtiriwscsrgrgvmilklpflkrrgggidptvkerlwltlhwpsnqptqlv
    sscfggellqwdltqswrrkytlfsassegqnhsrivfnlcplqteddkqlllstsmdrd
    vkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntlsiknnydvkn
    fwqgvkskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkktvytlawgp
    pvppmslggegdrpslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvht
    eiswkadgkimalgnedgsieifqipnlklictiqqhhklvntiswhhehgsqpelsylm
    asgsnnaviyvhnlktviesspespvtitepyrtlsghtakitsvawsphhdgrlvsasy
    dgtaqvwdalreeplcnfrghrgrllcvawspldpdciysgaddfcvhkwltsmqdhsrp
    pqgkksielekkrlsqpkak
    

    Sequence, based on observed residues (ATOM records):
    >5h3tA (A:)
    qeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigelvg
    htervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwsprvk
    dlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviidis
    kkgevihrlrghddeihsiawcplpcylatgskdqtiriwscsrgrgvmilklprlwltl
    hwpsnqptqlvsscfggellqwdltrkytlfsqnhsrivfnlcplqteddkqlllstsmd
    rdvkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntlsiknnydv
    knfwqgvkskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkktvytlaw
    gppvslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvhteiswkadgki
    malgnedgsieifqipnlklictiqqhhklvntiswhhehgsqpelsylmasgsnnaviy
    vhnlktviesspespvtitepyrtlsghtakitsvawsphhdgrlvsasydgtaqvwdal
    reeplcnfrghrgrllcvawspldpdciysgaddfcvhkwltsmqdhsrppq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h3tB (B:)
    mgqeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigel
    vghtervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwspr
    vkdlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviid
    iskkgevihrlrghddeihsiawcplpgedclsinqeetseeaeitngnavaqapvtkgc
    ylatgskdqtiriwscsrgrgvmilklpflkrrgggidptvkerlwltlhwpsnqptqlv
    sscfggellqwdltqswrrkytlfsassegqnhsrivfnlcplqteddkqlllstsmdrd
    vkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntlsiknnydvkn
    fwqgvkskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkktvytlawgp
    pvppmslggegdrpslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvht
    eiswkadgkimalgnedgsieifqipnlklictiqqhhklvntiswhhehgsqpelsylm
    asgsnnaviyvhnlktviesspespvtitepyrtlsghtakitsvawsphhdgrlvsasy
    dgtaqvwdalreeplcnfrghrgrllcvawspldpdciysgaddfcvhkwltsmqdhsrp
    pqgkksielekkrlsqpkak
    

    Sequence, based on observed residues (ATOM records):
    >5h3tB (B:)
    qeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigelvg
    htervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwsprvk
    dlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviidis
    kkgevihrlrghddeihsiawcplpgcylatgskdqtiriwscsrgrgvmilklprlwlt
    lhwpsnqptqlvsscfggellqwdltqrrkytlfsqnhsrivfnlcplqteddkqlllst
    smdrdvkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntlsiknn
    ydvknfwqskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkktvytlaw
    gppvpslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvhteiswkadgk
    imalgnedgsieifqinlklictiqqhhklvntiswhhehgsqpelsylmasgsnnaviy
    vhnlktviesspespvtitepyrtlsghtakitsvawsphhdgrlvsasydgtaqvwdal
    reeplcnfrghrgrllcvawspldpdciysgaddfcvhkwltsmqdhsrppq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h3tC (C:)
    mgqeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigel
    vghtervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwspr
    vkdlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviid
    iskkgevihrlrghddeihsiawcplpgedclsinqeetseeaeitngnavaqapvtkgc
    ylatgskdqtiriwscsrgrgvmilklpflkrrgggidptvkerlwltlhwpsnqptqlv
    sscfggellqwdltqswrrkytlfsassegqnhsrivfnlcplqteddkqlllstsmdrd
    vkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntlsiknnydvkn
    fwqgvkskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkktvytlawgp
    pvppmslggegdrpslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvht
    eiswkadgkimalgnedgsieifqipnlklictiqqhhklvntiswhhehgsqpelsylm
    asgsnnaviyvhnlktviesspespvtitepyrtlsghtakitsvawsphhdgrlvsasy
    dgtaqvwdalreeplcnfrghrgrllcvawspldpdciysgaddfcvhkwltsmqdhsrp
    pqgkksielekkrlsqpkak
    

    Sequence, based on observed residues (ATOM records):
    >5h3tC (C:)
    qeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigelvg
    htervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwsprvk
    dlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviidis
    kkgevihrlrghddeihsiawcplpgcylatgskdqtiriwscsrgrgvmilklplkrlw
    ltlhwpsnqptqlvsscfggellqwdltqswrrkytlfsqnhsrivfnlcplqteddkql
    llstsmdrdvkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntls
    iknnydvknfwkskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkktvy
    tlawgppvpslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvhteiswk
    adgkimalgnedgsieifqipnlklictiqqhhklvntiswhhehgsqpelsylmasgsn
    naviyvhnlktviesspespvtitepyrtlsghtakitsvawsphhdgrlvsasydgtaq
    vwdalreeplcnfrghrgrllcvawspldpdciysgaddfcvhkwltsmqdhsrppq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5h3tD (D:)
    mgqeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigel
    vghtervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwspr
    vkdlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviid
    iskkgevihrlrghddeihsiawcplpgedclsinqeetseeaeitngnavaqapvtkgc
    ylatgskdqtiriwscsrgrgvmilklpflkrrgggidptvkerlwltlhwpsnqptqlv
    sscfggellqwdltqswrrkytlfsassegqnhsrivfnlcplqteddkqlllstsmdrd
    vkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntlsiknnydvkn
    fwqgvkskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkktvytlawgp
    pvppmslggegdrpslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvht
    eiswkadgkimalgnedgsieifqipnlklictiqqhhklvntiswhhehgsqpelsylm
    asgsnnaviyvhnlktviesspespvtitepyrtlsghtakitsvawsphhdgrlvsasy
    dgtaqvwdalreeplcnfrghrgrllcvawspldpdciysgaddfcvhkwltsmqdhsrp
    pqgkksielekkrlsqpkak
    

    Sequence, based on observed residues (ATOM records):
    >5h3tD (D:)
    qeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigelvg
    htervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwsprvk
    dlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviidis
    kkgevihrlrghddeihsiawcplpgcylatgskdqtiriwscsrgrgvmilklprlwlt
    lhwpsnqptqlvsscfggellqwdltqswrrkytlfsqnhsrivfnlcplqteddkqlll
    stsmdrdvkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntlsik
    nnydvknfwqgvkskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkktv
    ytlawgppvpslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvhteisw
    kadgkimalgnedgsieifqinlklictiqqhhklvntiswhhehgsqpelsylmasgsn
    naviyvhnlktviesspespvtitepyrtlsghtakitsvawsphhdgrlvsasydgtaq
    vwdalreeplcnfrghrgrllcvawspldpdciysgaddfcvhkwltsmqdhsrppq