PDB entry 5h3n

View 5h3n on RCSB PDB site
Description: Solution structure of human Gelsolin protein domain 1 at pH 7.3
Class: structural protein
Keywords: gelsolin, STRUCTURAL PROTEIN
Deposited on 2016-10-26, released 2017-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gelsolin
  Species: Homo sapiens [TaxId:9606]
  Gene: GSN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06396 (0-132)
  Domains in SCOPe 2.08: d5h3na_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5h3nA (A:)
  ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
  wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
  gfkhvvpnevvvq