PDB entry 5h3k

View 5h3k on RCSB PDB site
Description: crystal structure of a hypothetical protein from synechocystis
Deposited on 2016-10-25, released 2017-10-25
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Slr0280 protein
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Gene: slr0280
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h3kA (A:)
    malgdllkmvnwtrnwfgfsclfvltlavmlglklflpspvvaqsssdfiqqgnqisidg
    ksypvawgqwqeggqtrtglgdtgamqflgldlldntspnqqpvqwfsgdrqtlnarfva
    pnryldvtsllqgfgplqaqgntlvmpntnaqiltvrdgrqswgervvlelsqpafwqvs
    qareeavvtinasstigsqgnanapglqaidqddlggktsggqqiryrlersgasskvhf
    qlpvgyklqvstltspfrlvidaradappvktinwtegitwqqrfvnisggqfpvttvti
    nprspgislrplmanptmaqgtaplvtiardqraavainagffnrnnqlplgavwsqqnw
    rsgpilnrgaiawndqgqttfgrlslseiittgsgqrltanylnsgyvqrgiarytpawg
    psyiplsdneqvyvvqnsqvtaqyplpkagqqqmpipsdgyliidrgnqipagvlavgtt
    lnvngrstpeafnafpngmgagpllidqgrmvlnatgegfssafqqqrasrsaiavdrng
    niilvashnrvggagaslgefaqilqqlgavnalnldggsstslalggqlldrspvtaar
    vsnaigvfvr
    

    Sequence, based on observed residues (ATOM records):
    >5h3kA (A:)
    sdfiqqgnqisidgksypvawgqwqeggqtrtglgdtgamqflgldlldntspnqqpvqw
    fsgdrqtlnarfvapnryldvtsllqgfgplqaqgntlvmpntnaqiltvrdgrqswger
    vvlelsqpafwqvsqareeavvtinassqiryrlersgasskvhfqlpvgyklqvstlts
    pfrlvidaradappvktinwtegitwqqrfvnisggqfpvttvtinprspgislrplman
    ptmaqgtaplvtiardqraavainagffnrnnqlplgavwsqqnwrsgpilnrgaiawnd
    qgqttfgrlslseiittgsgqrltanylnsgyvqrgiarytpawgpsyiplsdneqvyvv
    qnsqvtaqyplpkagqqqmpipsdgyliidrgnqipagvlavgttlnvngrstpeafnaf
    pngmgagpllidqgrmvlnatgegfssafqqqrasrsaiavdrngniilvashnrvggag
    aslgefaqilqqlgavnalnldggsstslalggqlldrspvtaarvsnaigvfvr