PDB entry 5h3e

View 5h3e on RCSB PDB site
Description: Crystal structure of mouse isocitrate dehydrogenases 2 K256Q mutant complexed with isocitrate
Class: oxidoreductase
Keywords: NADP dependent isocitrate dehydrogenases 2, OXIDOREDUCTASE
Deposited on 2016-10-23, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP], mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54071
      • engineered mutation (217)
    Domains in SCOPe 2.07: d5h3ea_
  • Chain 'B':
    Compound: Isocitrate dehydrogenase [NADP], mitochondrial
    Species: Mus musculus [TaxId:10090]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54071
      • engineered mutation (217)
    Domains in SCOPe 2.07: d5h3eb_
  • Heterogens: MG, ICT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h3eA (A:)
    maekrikvekpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvti
    dsalatqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiicknip
    rlvpgwtkpitigrhahgdqykatdfvvdragtfklvftpkdgssakewevynfpaggvg
    mgmyntdesisgfahscfqysiqkkwplylstkntilqaydgrfkdifqeifdkhyktdf
    dknkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpd
    gktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtl
    ekvcvqtvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgkqlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h3eA (A:)
    krikvekpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvtidsa
    latqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiickniprlv
    pgwtkpitigrhahgdqykatdfvvdragtfklvftpkdgssakewevynfpaggvgmgm
    yntdesisgfahscfqysiqkkwplylstkntilqaydgrfkdifqeifdkhyktdfdkn
    kiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkt
    ieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtlekv
    cvqtvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h3eB (B:)
    maekrikvekpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvti
    dsalatqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiicknip
    rlvpgwtkpitigrhahgdqykatdfvvdragtfklvftpkdgssakewevynfpaggvg
    mgmyntdesisgfahscfqysiqkkwplylstkntilqaydgrfkdifqeifdkhyktdf
    dknkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpd
    gktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtl
    ekvcvqtvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgkqlehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h3eB (B:)
    krikvekpvvemdgdemtriiwqfikeklilphvdvqlkyfdlglpnrdqtndqvtidsa
    latqkysvavkcatitpdearveefklkkmwkspngtirnilggtvfrepiickniprlv
    pgwtkpitigrhahgdqykatdfvvdragtfklvftpkdgssakewevynfpaggvgmgm
    yntdesisgfahscfqysiqkkwplylstkntilqaydgrfkdifqeifdkhyktdfdkn
    kiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkt
    ieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqtlekv
    cvqtvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgk