PDB entry 5h39

View 5h39 on RCSB PDB site
Description: Structural analysis of KSHV thymidylate synthase
Class: transferase
Keywords: thymidylate synthase, inhibitor, raltitrexed, dUMP, TRANSFERASE
Deposited on 2016-10-21, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf70
    Species: Human herpesvirus 8 [TaxId:37296]
    Gene: ORF70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h39a_
  • Chain 'B':
    Compound: orf70
    Species: Human herpesvirus 8 [TaxId:37296]
    Gene: ORF70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h39b_
  • Heterogens: UMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h39A (A:)
    pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq
    ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay
    vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg
    elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr
    lqltrtprpfprleilrsvssmeeftpddfrlvdycphptirmem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h39B (B:)
    pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq
    ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay
    vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg
    elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr
    lqltrtprpfprleilrsvssmeeftpddfrlvdycphptirmem
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h39B (B:)
    pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq
    ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay
    vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg
    elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr
    lqltrtprpfprleilrsvssmeeftpddfrlvdycphptirm