PDB entry 5h37

View 5h37 on RCSB PDB site
Description: cryo-em structure of zika virus complexed with fab c10 at ph 8.0
Deposited on 2016-10-20, released 2016-11-30
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: EM
Resolution: 4 Å
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: structural protein E
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: structural protein E
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: structural protein E
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: strutural protein M
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: strutural protein M
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: strutural protein M
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: C10 IgG heavy chain variable region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H37 (0-126)
  • Chain 'H':
    Compound: C10 IgG light chain variable region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H37 (0-108)
  • Chain 'I':
    Compound: C10 IgG heavy chain variable region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H37 (0-126)
  • Chain 'K':
    Compound: C10 IgG heavy chain variable region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H37 (0-126)
  • Chain 'L':
    Compound: C10 IgG light chain variable region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H37 (0-108)
  • Chain 'M':
    Compound: C10 IgG light chain variable region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H37 (0-108)
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5h37A (A:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
    ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
    alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
    kgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlit
    anpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigkafeatvrgakr
    mavlgdtawdfgsvggalnslgkgihqifgaafkslfggmswfsqiligtllmwlglntk
    ngsislmclalggvliflstavsa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h37B (B:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
    ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
    alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
    kgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlit
    anpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigkafeatvrgakr
    mavlgdtawdfgsvggalnslgkgihqifgaafkslfggmswfsqiligtllmwlglntk
    ngsislmclalggvliflstavsa
    

    Sequence, based on observed residues (ATOM records):
    >5h37B (B:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgdenrakveitpnspraeatlggfgslgldc
    eprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdaha
    krqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsyslcta
    aftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpviteste
    nskmmleldppfgdsyivigvgekkithhwhrsgstigkafeatvrgakrmavlgdtawd
    fgsvggalnslgkgihqifgaafkslfggmswfsqiligtllmwlglntkngsislmcla
    lggvliflstavsa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h37C (C:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
    ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
    alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
    kgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlit
    anpvitestenskmmleldppfgdsyivigvgekkithhwhrsgstigkafeatvrgakr
    mavlgdtawdfgsvggalnslgkgihqifgaafkslfggmswfsqiligtllmwlglntk
    ngsislmclalggvliflstavsa
    

    Sequence, based on observed residues (ATOM records):
    >5h37C (C:)
    ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
    yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
    cskkmtgksiqpenleyrimlsvhgsqhsgdenrakveitpnspraeatlggfgslgldc
    eprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdaha
    krqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgvsyslcta
    aftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpviteste
    nskmmleldppfgdsyivigvgekkithhwhrsgstigkafeatvrgakrmavlgdtawd
    fgsvggalnslgkgihqifgaafkslfggmswfsqiligtllmwlglntkngsislmcla
    lggvliflstavsa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5h37D (D:)
    avtlpshstrklqtrsqtwlesreytkhlirvenwifrnpgfalaaaaiawllgsstsqk
    viylvmilliapays
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5h37E (E:)
    avtlpshstrklqtrsqtwlesreytkhlirvenwifrnpgfalaaaaiawllgsstsqk
    viylvmilliapays
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5h37F (F:)
    avtlpshstrklqtrsqtwlesreytkhlirvenwifrnpgfalaaaaiawllgsstsqk
    viylvmilliapays
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >5h37G (G:)
    evqlvesgaevkkpgasvkvsckasgytftsyamhwvrqapgqrlewmgwinagngntky
    sqkfqdrvtitrdtsastaymelsslrsedtaiyycardkvddygdywfptlwyfdywgq
    gtlvtvs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >5h37H (H:)
    saltqpasvsgspgqsitisctgtssdvggfnyvswfqqhpgkapklmlydvtsrpsgvs
    srfsgsksgntasltisglqaedeadyycsshtsrgtwvfgggtkltvl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >5h37I (I:)
    evqlvesgaevkkpgasvkvsckasgytftsyamhwvrqapgqrlewmgwinagngntky
    sqkfqdrvtitrdtsastaymelsslrsedtaiyycardkvddygdywfptlwyfdywgq
    gtlvtvs
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >5h37K (K:)
    evqlvesgaevkkpgasvkvsckasgytftsyamhwvrqapgqrlewmgwinagngntky
    sqkfqdrvtitrdtsastaymelsslrsedtaiyycardkvddygdywfptlwyfdywgq
    gtlvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >5h37L (L:)
    saltqpasvsgspgqsitisctgtssdvggfnyvswfqqhpgkapklmlydvtsrpsgvs
    srfsgsksgntasltisglqaedeadyycsshtsrgtwvfgggtkltvl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >5h37M (M:)
    saltqpasvsgspgqsitisctgtssdvggfnyvswfqqhpgkapklmlydvtsrpsgvs
    srfsgsksgntasltisglqaedeadyycsshtsrgtwvfgggtkltvl