PDB entry 5h33

View 5h33 on RCSB PDB site
Description: structural basis for dimerization of the death effector domains of caspase-8
Deposited on 2016-10-20, released 2017-10-25
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP8, MCH5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14790
      • engineered mutation (121)
  • Chain 'B':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP8, MCH5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14790
      • engineered mutation (121)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h33A (A:)
    mdfsrnlydigeqldsedlaslkflsldyipqrkqepikdalmlfqrlqekrmleesnls
    flkellfrinrldllitylntrkeemerelqtpgraqisayrvmlyqiseevsrselrsf
    kallqeeiskckldddmnlldifiemekrvilgegkldilkrvcaqinksllkiindyee
    fskersss
    

    Sequence, based on observed residues (ATOM records):
    >5h33A (A:)
    dfsrnlydigeqldsedlaslkflsldyipqrkqepikdalmlfqrlqekrmleesnlsf
    lkellfrinrldllitylntrkeemerelqtpgraqisayrvmlyqiseevsrselrsfk
    allqeeiskckldddmnlldifiemekrvilgegkldilkrvcaqinksllkiindyeef
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h33B (B:)
    mdfsrnlydigeqldsedlaslkflsldyipqrkqepikdalmlfqrlqekrmleesnls
    flkellfrinrldllitylntrkeemerelqtpgraqisayrvmlyqiseevsrselrsf
    kallqeeiskckldddmnlldifiemekrvilgegkldilkrvcaqinksllkiindyee
    fskersss
    

    Sequence, based on observed residues (ATOM records):
    >5h33B (B:)
    dfsrnlydigeqldsedlaslkflsldyipqrkqepikdalmlfqrlqekrmleesnlsf
    lkellfrinrldllitylntrkeemerelqtpgraqisayrvmlyqiseevsrselrsfk
    allqeeiskckldddmnlldifiemekrvilgegkldilkrvcaqinksllkiindyeef
    s