PDB entry 5h2v

View 5h2v on RCSB PDB site
Description: crystal structure of the karyopherin kap121p bound to the sumo protease ulp1p
Deposited on 2016-10-18, released 2016-12-14
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit beta-3
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PSE1, KAP121, YMR308C, YM9952.10C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-like-specific protease 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ULP1, YPL020C, LPB11C
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h2vA (A:)
    msalpeevnrtllqivqafaspdnqirsvaekalseewitennieylltflaeqaafsqd
    ttvaalsavlfrklalkapithirkevlaqirssllkgflseradsirhklsdaiaecvq
    ddlpawpellqalieslksgnpnfressfrilttvpylitavdinsilpifqsgftdasd
    nvkiaavtafvgyfkqlpksewsklgillpsllnslprflddgkddalasvfeslielve
    lapklfkdmfdqiiqftdmviknkdlepparttalelltvfsenapqmcksnqnygqtlv
    mvtlimmtevsiddddaaewiesddtddeeevtydharqaldrvalklggeylaaplfqy
    lqqmitstewrerfaammalssaaegcadvligeipkildmviplindphprvqygccnv
    lgqistdfspfiqrtahdrilpaliskltsectsrvqthaaaalvnfsefaskdilepyl
    dslltnllvllqsnklyvqeqalttiafiaeaaknkfikyydtlmplllnvlkvnnkdns
    vlkgkcmecatligfavgkekfhehsqelisilvalqnsdideddalrsyleqswsricr
    ilgddfvpllpivippllitakatqdvglieeeeaanfqqypdwdvvqvqgkhiaihtsv
    lddkvsamellqsyatllrgqfavyvkevmeeialpsldfylhdgvraagatlipillsc
    llaatgtqneelvllwhkasskligglmsepmpeitqvyhnslvngikvmgdnclsedql
    aaftkgvsanltdtyermqdrhgdgdeynenideeedftdedlldeinksiaavlkttng
    hylknleniwpmintflldnepilvifalvvigdliqyggeqtasmknafipkvteclis
    pdarirqaasyiigvcaqyapstyadvciptldtlvqivdfpgskleenrsstenasaai
    akilyaynsnipnvdtytanwfktlptitdkeaasfnyqflsqliennspivcaqsnisa
    vvdsviqalnerslteregqtvissvkkllgflpssdamaifnrypadimekvhkwfa
    

    Sequence, based on observed residues (ATOM records):
    >5h2vA (A:)
    alpeevnrtllqivqafasnqirsvaekalseewitennieylltflaeqaafsqdttva
    alsavlfrklalkapithirkevlaqirssllkgflseradsirhklsdaiaecvqddlp
    awpellqalieslksgnpnfressfrilttvpylitavdinsilpifqsgftdasdnvki
    aavtafvgyfkqlpksewsklgillpsllnslprflddgkddalasvfeslielvelapk
    lfkdmfdqiiqftdmviknkdlepparttalelltvfsenapqmcksnqnygqtlvmvtl
    immtevsiddddaaewiesddtddeeevtydharqaldrvalklggeylaaplfqylqqm
    itstewrerfaammalssaaegcadvligeipkildmviplindphprvqygccnvlgqi
    stdfspfiqrtahdrilpaliskltsectsrvqthaaaalvnfsefaskdilepyldsll
    tnllvllqsnklyvqeqalttiafiaeaaknkfikyydtlmplllnvlkvnsvlkgkcme
    catligfavgkekfhehsqelisilvalqnsdalrsyleqswsricrilgddfvpllpiv
    ippllitakatqdvglieeeeaanfqqypdwdvvkhiaihtsvlddkvsamellqsyatl
    lrgqfavyvkevmeeialpsldfylhdgvraagatlipillscllaaneelvllwhkass
    kligglmsepmpeitqvyhnslvngikvmgdnclsedqlaaftkgvsanltdtyermqdd
    eynedftdedlldeinksiaavlkttnghylknleniwpmintflldnepilvifalvvi
    gdliqyggeqtasmknafipkvteclispdarirqaasyiigvcaqyapstyadvciptl
    dtlvqivdgskleenrsstenasaaiakilyaydtytanwfktlptitdkeaasfnyqfl
    sqliepivcaqsnisavvdsviqalnerslegqtvissvkkllgfldamaifnrypadim
    ekvhkwf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h2vB (B:)
    msvevdkhrntlqyhkknpysplfspistyrcyprvlnnpsesrrsasfsgiykkrtnts
    rfnylndrrvlsmeesmkdgsdraskagfiggiretlwnsgkylwhtfvkneprnfdgse
    veasgnsdvesrssgsrssdvpyglrenys
    

    Sequence, based on observed residues (ATOM records):
    >5h2vB (B:)
    giykk