PDB entry 5h2r

View 5h2r on RCSB PDB site
Description: Crystal structure of T brucei phosphodiesterase B2 bound to compound 15b
Class: hydrolase
Keywords: Phosphodiesterase Inhibitor Trypanosoma brucei, HYDROLASE
Deposited on 2016-10-17, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphodiesterase
    Species: Trypanosoma brucei brucei [TaxId:185431]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h2ra_
  • Chain 'B':
    Compound: phosphodiesterase
    Species: Trypanosoma brucei brucei [TaxId:185431]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h2rb_
  • Heterogens: ZN, MG, LLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h2rA (A:)
    gshmvtaitnrereavlriefpnvdvtdidfdlfqarestdkpldvaaaiayrlllgsgl
    pqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtiytflyrgnvyekltelecfv
    llitalvhdldhmglnnsfylktesplgilssasgnksvlevhhcnlaveilsdpesdvf
    gglegaertlafrsmidcvlatdmarhseflekylelmktsynvddsdhrqmtmdvlmka
    gdisnvtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidf
    vaapffqkivdaclqgmqwtvdrtksnraqwervlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h2rA (A:)
    aitnrereavlriefpnvdvtdidfdlfqarestdkpldvaaaiayrlllgsglpqkfgc
    sdevllnfilqcrkkyrnvpyhnfyhvvdvcqtiytflyrgnvyekltelecfvllital
    vhdldhmglnnsfylktesplgilssasgnksvlevhhcnlaveilsdpesdvfgglega
    ertlafrsmidcvlatdmarhseflekylelmktsynvddsdhrqmtmdvlmkagdisnv
    tkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapff
    qkivdaclqgmqwtvdrtksnraqwervl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h2rB (B:)
    gshmvtaitnrereavlriefpnvdvtdidfdlfqarestdkpldvaaaiayrlllgsgl
    pqkfgcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtiytflyrgnvyekltelecfv
    llitalvhdldhmglnnsfylktesplgilssasgnksvlevhhcnlaveilsdpesdvf
    gglegaertlafrsmidcvlatdmarhseflekylelmktsynvddsdhrqmtmdvlmka
    gdisnvtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidf
    vaapffqkivdaclqgmqwtvdrtksnraqwervlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h2rB (B:)
    taitnrereavlriefpnvdvtdidfdlfqarestdkpldvaaaiayrlllgsglpqkfg
    csdevllnfilqcrkkyrnvpyhnfyhvvdvcqtiytflyrgnvyekltelecfvllita
    lvhdldhmglnnsfylktesplgilssasgnksvlevhhcnlaveilsdpesdvfggleg
    aertlafrsmidcvlatdmarhseflekylelmktvddsdhrqmtmdvlmkagdisnvtk
    pfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapffqk
    ivdaclqgmqwtvdrtksnraqwervle