PDB entry 5h2j

View 5h2j on RCSB PDB site
Description: A three dimensional movie of structural changes in bacteriorhodopsin: structure obtained 290 ns after photoexcitation
Class: proton transport
Keywords: bacteriorhodopsin, XFEL, time-resolved serial femtosecond crystallography, SACLA, PROTON TRANSPORT
Deposited on 2016-10-15, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium salinarum NRC-1 [TaxId:64091]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h2ja_
  • Heterogens: RET, L2P, TRD, D10, HP6, OCT, MYS, UND, DD9, C14, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h2jA (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h2jA (A:)
    itgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllg
    ygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtgl
    vgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlws
    aypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeae