PDB entry 5h23

View 5h23 on RCSB PDB site
Description: Crystal structure of Chikungunya virus capsid protein
Class: viral protein
Keywords: Chikungunya virus, capsid protein, VIRAL PROTEIN
Deposited on 2016-10-14, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h23a_
  • Chain 'B':
    Compound: capsid protein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h23b_
  • Heterogens: EDO, PEG, GOL, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h23A (A:)
    cmkiendcifevkhegkvtgyaclvgdkvmkpahvkgtidnadlaklafkrsskydleca
    qipvhmksdaskfthekpegyynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvv
    aivlgganegartalsvvtwnkdivtkitpegaeew
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h23A (A:)
    ndcifevkhegkvtgyaclvgdkvmkpahvkgtidnadlaklafkrsskydlecaqipvh
    mksdaskfthekpegyynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlg
    ganegartalsvvtwnkdivtkitpegaeew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h23B (B:)
    cmkiendcifevkhegkvtgyaclvgdkvmkpahvkgtidnadlaklafkrsskydleca
    qipvhmksdaskfthekpegyynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvv
    aivlgganegartalsvvtwnkdivtkitpegaeew
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h23B (B:)
    ndcifevkhegkvtgyaclvgdkvmkpahvkgtidnadlaklafkrsskydlecaqipvh
    mksdaskfthekpegyynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlg
    ganegartalsvvtwnkdivtkitpegaeew