PDB entry 5h1r

View 5h1r on RCSB PDB site
Description: c. elegans inx-6 gap junction channel
Deposited on 2016-10-11, released 2016-12-07
The last revision was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: EM
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h1rA (A:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rA (A:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h1rB (B:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rB (B:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h1rC (C:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rC (C:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5h1rD (D:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rD (D:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5h1rE (E:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rE (E:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5h1rF (F:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rF (F:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5h1rG (G:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rG (G:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5h1rH (H:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rH (H:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5h1rI (I:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rI (I:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5h1rJ (J:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rJ (J:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5h1rK (K:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rK (K:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5h1rL (L:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rL (L:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5h1rM (M:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rM (M:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5h1rN (N:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rN (N:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5h1rO (O:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rO (O:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5h1rP (P:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1rP (P:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf