PDB entry 5h1q

View 5h1q on RCSB PDB site
Description: c. elegans inx-6 gap junction hemichannel
Deposited on 2016-10-11, released 2016-12-07
The last revision was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: EM
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Innexin-6
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: inx-6, opu-6, C36H8.2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h1qA (A:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1qA (A:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    i
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h1qB (B:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1qB (B:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    i
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h1qC (C:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1qC (C:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5h1qD (D:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1qD (D:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    i
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5h1qE (E:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1qE (E:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    i
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5h1qF (F:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1qF (F:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    i
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5h1qG (G:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1qG (G:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    i
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5h1qH (H:)
    masqvgainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfigdpitcwt
    paqfnaqwvnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfy
    iprfiwkamiaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirla
    rkkrsrnmalfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttg
    hfprivhcdfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiy
    ylcnktkaqktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltis
    mrnicqdfiesedyideertpfvksikht
    

    Sequence, based on observed residues (ATOM records):
    >5h1qH (H:)
    ainsvnalisrvfvqpkgdladrlnsrvtvvilavssalllsshfdpitcwtpaqfnaqw
    vnfvnqycfvhgtyfvpldqqlafeeeertkvsiqyyqwvpyvfalqaflfyiprfiwka
    miaysgydlaaavkyvdrfwsenrdkddkfktrlaafegrpsvyiwdgirlarkkrsrnm
    alfytlstvwqavnawiqfyiltqlldssiytlwgpsilgdllqgndwqttghfprivhc
    dfnrrrpasvqldtvlcvltlniyyeklfiflwfwlvfvavvstvncfkwiyylcnktka
    qktiknylstapikstisddqffsalgedglfimdqmalnlgdipasyltismrnicqdf
    i