PDB entry 5h1p

View 5h1p on RCSB PDB site
Description: CRISPR-associated protein
Class: hydrolase
Keywords: CRISPR-associated protein, Endonuclease, HYDROLASE
Deposited on 2016-10-11, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRISPR-associated endoribonuclease Cas2
    Species: Xanthomonas albilineans (strain GPE PC73 / CFBP 7063) [TaxId:380358]
    Gene: cas2, XALc_2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h1pa_
  • Chain 'B':
    Compound: CRISPR-associated endoribonuclease Cas2
    Species: Xanthomonas albilineans (strain GPE PC73 / CFBP 7063) [TaxId:380358]
    Gene: cas2, XALc_2892
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h1pb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h1pA (A:)
    mmvlvsydvstsspggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlid
    pdidslrfyhlgakwearvehvgakpsldlkgpliflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h1pA (A:)
    mmvlvsydvstsspggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlid
    pdidslrfyhlgakwearvehvgakp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h1pB (B:)
    mmvlvsydvstsspggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlid
    pdidslrfyhlgakwearvehvgakpsldlkgpliflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h1pB (B:)
    mmvlvsydvstpggdkrlrkvakacrdlgqrvqfsvfeievdpaqwtalrqrlcdlidpd
    idslrfyhlgakwearvehvgak