PDB entry 5h1l

View 5h1l on RCSB PDB site
Description: crystal structure of wd40 repeat domains of gemin5 in complex with 7- nt u4 snrna fragment
Deposited on 2016-10-10, released 2016-11-23
The last revision was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gem-associated protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: U4 snRNA (5'-R(*AP*UP*UP*UP*UP*UP*G)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h1lA (A:)
    gamgirnsmgqeprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtp
    pfrvigelvghtervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhti
    stlhwsprvkdlivsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigyk
    dgivviidiskkgevihrlrghddeihsiawcplpgedclsinqeetseeaeitngnava
    qapvtkgcylatgskdqtiriwscsrgrgvmilklpflkrrgggidptvkerlwltlhwp
    snqptqlvsscfggellqwdltqswrrkytlfsassegqnhsrivfnlcplqteddkqll
    lstsmdrdvkcwdiatlecswtlpslggfayslafssvdigslaigvgdgmirvwntlsi
    knnydvknfwqgvkskvtalcwhptkegclafgtddgkvglydtysnkppqisstyhkkt
    vytlawgppvppmslggegdrpslalyscggegivlqhnpwklsgeafdinklirdtnsi
    kyklpvhteiswkadgkimalgnedgsieifqipnlklictiqqhhklvntiswhhehgs
    qpelsylmasgsnnaviyvhnlktviesspespvtitepyrtlsghtakitsvawsphhd
    grlvsasydgtaqvwdalreeplcnfrghrgrllcvawspldpdciysgaddfcvhkwlt
    smqdhsrppqgkks
    

    Sequence, based on observed residues (ATOM records):
    >5h1lA (A:)
    eprtlppspnwycarcsdavpgglfgfaartsvflvrvgpgagespgtppfrvigelvgh
    tervsgftfshhpgqynlcatssddgtvkiwdvetktvvtehalhqhtistlhwsprvkd
    livsgdekgvvfcywfnrndsqhlfieprtifcltcsphhedlvaigykdgivviidisk
    kgevihrlrghddeihsiawcplpgegcylatgskdqtiriwscsrgrgvmilklpflkr
    rgggidptvkerlwltlhwpsnqptqlvsscfggellqwdltqswrrkytlfsassegqn
    hsrivfnlcplqteddkqlllstsmdrdvkcwdiatlecswtlpslggfayslafssvdi
    gslaigvgdgmirvwntlsiknnydvknfwqgvkskvtalcwhptkegclafgtddgkvg
    lydtysnkppqisstyhkktvytlawgppvppmsslalyscggegivlqhnpwklsgeaf
    dinklirdtnsikyklpvhteiswkadgkimalgnedgsieifqipnlklictiqqhhkl
    vntiswhhehgsqpelsylmasgsnnaviyvhnlktviesspespvtitepyrtlsghta
    kitsvawsphhdgrlvsasydgtaqvwdalreeplcnfrghrgrllcvawspldpdciys
    gaddfcvhkwltsmqdhsrppq
    

  • Chain 'B':
    No sequence available.