PDB entry 5h18

View 5h18 on RCSB PDB site
Description: crystal structure of catalytic domain of uggt (udp-glucose-bound form) from thermomyces dupontii
Deposited on 2016-10-08, released 2017-09-27
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uggt
    Species: Thermomyces dupontii [TaxId:28565]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H18
  • Heterogens: UPG, CA, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h18A (A:)
    gsadinifsvasghlyermlnimmvsvmkhtkhsvkfwfieqflspsfkkflphlakeyg
    fsyemvtykwphwlrgqrekqreiwgykilfldvlfplsldkvifvdadqivrtdmydlv
    qldlegapygftpmcdsrkemegfrfwkqgywkshlrgrpyhisalyvvdlnrfralaag
    drlrgqyhtlsadpnslanldqdlpnnmqamipikslpqewlwcetwcadedlktartid
    lcnnpltkepkldrarrqvpewteydneiaelavrvraaskqsrreedekkdv
    

    Sequence, based on observed residues (ATOM records):
    >5h18A (A:)
    adinifsvasghlyermlnimmvsvmkhtkhsvkfwfieqflspsfkkflphlakeygfs
    yemvtykwphwlrgqrekqreiwgykilfldvlfplsldkvifvdadqivrtdmydlvql
    dlegapygftpmcdsrkemegfrfwkqgywkshlrgrpyhisalyvvdlnrfralaagdr
    lrgqyhtlsaanldqdlpnnmqamipikslpqewlwcetwcadedlktartidlcnnplt
    kepkldrarrqvpewteydneiaelavrvraa