PDB entry 5h16

View 5h16 on RCSB PDB site
Description: Crystal structure of the complex of Phosphopantetheine adenylyltransferase from Acinetobacter baumannii with citrate at 2.3 A resolution.
Class: transferase
Keywords: transferase
Deposited on 2016-10-08, released 2016-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h16a_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h16b_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h16c_
  • Chain 'D':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h16d_
  • Chain 'E':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h16e_
  • Chain 'F':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5h16f_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h16A (A:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5h16B (B:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h16B (B:)
    ktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqsslgh
    lsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavfltps
    eqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5h16C (C:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h16C (C:)
    ktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqsslgh
    lsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavfltps
    eqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5h16D (D:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h16D (D:)
    ktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqsslgh
    lsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavfltps
    eqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h16E (E:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h16F (F:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw