PDB entry 5h12

View 5h12 on RCSB PDB site
Description: crystal structure of deep vent dna polymerase
Deposited on 2016-10-07, released 2017-01-25
The last revision was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deep Vent DNA Polymerase
    Species: Pyrococcus [TaxId:2260]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H12 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h12A (A:)
    mildadyitedgkpiirifkkengefkveydrnfrpyiyallkddsqidevrkitaerhg
    kivriidaekvrkkflgrpievwrlyfehpqdvpairdkirehsavidifeydipfakry
    lidkglipmegdeelkllafdietlyhegeefakgpiimisyadeeeakvitwkkidlpy
    vevvsseremikrflkvirekdpdviityngdsfdlpylvkraeklgiklplgrdgsepk
    mqrlgdmtaveikgrihfdlyhvirrtinlptytleavyeaifgkpkekvyaheiaeawe
    tgkglervakysmedakvtyelgreffpmeaqlsrlvgqplwdvsrsstgnlvewyllrk
    ayernelapnkpdereyerrlresyaggyvkepekglweglvsldfrslypsiiithnvs
    pdtlnregcreydvapevghkfckdfpgfipsllkrllderqeikrkmkaskdpiekkml
    dyrqraikilansyygyygyakarwyckecaesvtawgreyiefvrkeleekfgfkvlyi
    dtdglyatipgakpeeikkkalefvdyinaklpglleleyegfyvrgffvtkkkyalide
    egkiitrgleivrrdwseiaketqakvleailkhgnveeavkivkevteklskyeippek
    lviyeqitrplheykaigphvavakrlaargvkvrpgmvigyivlrgdgpiskrailaee
    fdlrkhkydaeyyienqvlpavlrileafgyrkedlrwqktkqtgltawlnikkk
    

    Sequence, based on observed residues (ATOM records):
    >5h12A (A:)
    mildadyitedgkpiirifkkengefkveydrnfrpyiyallkddsqidevrkitaerhg
    kivriidaekvrkkflgrpievwrlyfehpqdvpairdkirehsavidifeydipfakry
    lidkglipmegdeelkllafdietlyhegeefakgpiimisyadeeeakvitwkkidlpy
    vevvsseremikrflkvirekdpdviityngdsfdlpylvkraeklgiklplgrdgsepk
    mqtaveikgrihfdlyhvirrtinlptytleavyeaifgkpkekvyaheiaeawetgkgl
    ervakysmedakvtyelgreffpmeaqlsrlvgqplwdvsrsstgnlvewyllrkayern
    elapnkpdereyerrlresyaggyvkepekglweglvsldfrslypsiiithnvspdtln
    regcreydvapevghkfckdfpgfipsllkrllderqeikrkmkaskdpiekkmldyrqr
    aikilansyygyygyakarwyckecaesvtawgreyiefvrkeleekfgfkvlyidtdgl
    yatipgakpeeikkkalefvdyinaklpglleleyegfyvrgffvtkkkyalideegkii
    trgleivrrdwseiaketqakvleailkhgnveeavkivkevteklskyeippeklviye
    qitrplheykaigphvavakrlaargvkvrpgmvigyivlrgdgpiskrailaeefdlrk
    hkydaeyyienqvlpavlrileafgyrkedlrw